KEGG   Rhizobium etli CFN 42: RHE_CH00571Help
Entry
RHE_CH00571       CDS       T00317                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ret  Rhizobium etli CFN 42
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHE_CH00571
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHE_CH00571
   00650 Butanoate metabolism
    RHE_CH00571
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_CH00571
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHE_CH00571
   00310 Lysine degradation
    RHE_CH00571
   00360 Phenylalanine metabolism
    RHE_CH00571
   00380 Tryptophan metabolism
    RHE_CH00571
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHE_CH00571
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHE_CH00571
   00281 Geraniol degradation
    RHE_CH00571
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHE_CH00571
   00627 Aminobenzoate degradation
    RHE_CH00571
   00930 Caprolactam degradation
    RHE_CH00571
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHE_CH00571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
595073..596125
Genome map
AA seq 350 aa AA seqDB search
MQDSEVIIERRGTAGIIRLNRPRALNSLTLAMIRTITEALDGFARDAEVATVVATGEGER
GFCAGGDIRALHESARAGDGLAGTFWREEFRLNHMIAVYPKPYVALMDGITMGGGVGLSS
HGRHRIVTERTRLAMPETGIGYVPDVGATWLLPKAPGEAGTWLGLTGLDIAAADAIYAHL
ADLQIASSRLAEVIETLSGLPRGSSSGDVDGVLQVYAEPPGESRLRHNSTMIDRAFRFDS
VEEILAALAGEDGEFAAETRRVLLTRSPTSLKLALQLLRAGRRSGSLAECLGRELGACLQ
MLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVKAQTVENFLKPAEPPLLL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacagcgaagtcatcatcgagcggcgaggcactgccggcatcatccggctcaac
cggccgcgggcgctgaacagcctgacgctggcgatgatccggacgatcaccgaggcgctg
gatggctttgcccgcgacgccgaggtggcgactgtcgtggcaacaggggagggcgaacgc
ggtttctgcgccggcggcgatatccgcgccctgcatgagagcgcccgggccggcgacggc
ctcgccggaaccttctggcgggaagaattccgtctcaaccatatgatcgccgtctacccc
aaaccctatgtcgcgctgatggacggcatcaccatgggcggcggcgtcggcctgtcctcg
cacggccgccaccgcatcgtcaccgagcgcacccggctggcgatgccggaaaccggcatc
ggctacgtcccggatgtcggggccacctggttgctgccgaaggcacccggggaggccgga
acatggctcggtctgaccgggctcgatatcgccgcggccgacgcgatatacgcccacctt
gccgatcttcagatcgcctcgtcgcggctcgcagaagtgatcgagacattgtcgggcctg
ccgcgcggcagttcgtcgggtgatgtcgatggcgtcctgcaagtatacgcagagcctccg
ggcgagagccgactgcggcacaactcgactatgatcgaccgcgctttccgattcgacagc
gtcgaggagattctggcggcgctcgccggggaggatggcgaattcgccgctgagacgcgc
cgcgtgctgctgacgcgctcgccgaccagcctgaagctcgctttgcagctcctgagagcc
ggccgccgcagcggctcgctcgccgaatgtctcggccgcgagctcggcgcctgcctgcag
atgctggataatcccgatttcttcgaaggcatccgcgccgccgtcatcgacaaggaccgc
aatccgaaatggtcgccggcctctgtcgaggctgtcaaggcgcaaacggtcgagaacttc
ctgaaaccggccgagccgccgcttttgctctga

DBGET integrated database retrieval system