KEGG   Rhizobium etli CFN 42: RHE_CH00579Help
Entry
RHE_CH00579       CDS       T00317                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ret  Rhizobium etli CFN 42
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ret00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ret00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
602158..603450
Genome map
AA seq 430 aa AA seqDB search
MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVPHLADVELLMRILGNH
GVDVAVNGRRERQEDSYARTIHFTCRTIVDTTASYELVSKMRASFWVIGPLLAREGHCRV
SLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPDGGLIGARYTFPKVSVGATHV
LMMAATLARGTTVIGNAAREPEVVDLANCLNAMGAKISGAGTSTITIEGVTSLSGARHRV
LPDRIETGTYAMAVAMAGGDVVLENTDVALLDTALETLRRAGADISATNNGMRVRRNGAG
IKPVDIVTDPFPGFPTDLQAQFMALMTRSSGISHVTETIFENRFMHVQELARLGARISLS
GQTAKIEGVERLRGAPVMATDLRASVSLVIAGLAAEGETTVSRVYHLDRGFERLEAKLTR
CGAVVERISE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtatcagaattgtcggcggtaatgagctgaatggcatcattccgatttccggc
gccaagaatgccgcactgccgctgatgatcgcctcgcttctgaccagtgacacgctgacg
ctggaaaacgtgccgcatctggccgatgtcgagcttctgatgcgcatcctcggcaatcat
ggcgtcgatgtcgccgtcaacggccgccgcgagcgccaggaggactcctacgcccgcacg
atccatttcacctgccgcaccatcgtcgataccaccgcttcttatgaactggtctcgaag
atgcgcgcctccttctgggtcatcgggccactgctggcgcgcgaaggccattgccgcgtg
tcgctgccgggcggctgcgccatcggcacgcgccccgtcgatcttttcatcgaaggcctg
acggcgctcggcgcgaccatggagatcgatgccggttacatcaacgccaaggctccggat
ggcggcctgatcggcgcgcgctacaccttcccgaaggtttcggtcggcgccacccatgtg
ttgatgatggcggcaacgcttgcccgcggcacgacggttatcggcaatgccgcccgcgaa
cccgaagtcgtcgatctcgccaactgcctgaacgccatgggcgccaagatatcaggcgcc
ggcacctcgaccatcaccatcgaaggcgtcacctcgctctcgggcgcccgtcatcgcgtc
ctgccggaccgcatcgagaccggcacctacgccatggccgtcgccatggccggcggtgac
gtcgtgctcgaaaataccgatgtggcgctgctcgataccgcgctggaaaccctgcgccgg
gccggcgccgacatctccgcgaccaataacggcatgcgcgtcaggcgcaacggcgccggc
atcaagccggtcgatatcgtcaccgatcccttcccgggtttccccaccgatctgcaggcg
cagttcatggcgctgatgacccgctcctccggcatctcgcatgtcaccgagacaatcttc
gaaaatcgcttcatgcacgtgcaggagcttgcccggctgggcgccaggatttcgctctcc
ggccagacggcgaagatcgaaggtgtcgaacgcctgcgcggcgcgcctgtgatggcgacc
gatctgcgtgcctccgtctcgctcgtcatcgccggtctcgccgccgagggtgaaactacg
gtctcccgcgtctaccacctcgaccgcggcttcgaacggctcgaagcgaagctgacccgc
tgcggcgcagtcgtcgagcgcatcagcgagtaa

DBGET integrated database retrieval system