KEGG   Rhizobium etli CFN 42: RHE_CH00581Help
Entry
RHE_CH00581       CDS       T00317                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase 1 protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00340  Histidine metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RHE_CH00581 (hisD)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RHE_CH00581 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABC89398
RhizoBase: RHE_CH00581
UniProt: Q2KCN8
Position
604081..605376
Genome map
AA seq 431 aa AA seqDB search
MAIWLDQASEGFEQHFAAFLTTKREVSEDVNAVARAIIDDVRTRGDVALAEYSLKFDGID
FAAVPMRVTPEEIDAAIEAVPAEVLGALKLAALRIESHHRRQLPKDDIYEDDLGVGLGSR
WTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERVVIAVPATGGAVNPAVLAAARLAG
VSEIYRVGGAQAIAALAYGTDTIAPVAKITGPGNAYVAAAKRHVFGTVGIDMIAGPSEVL
VIADKDNNPDWIAADLLAQAEHDASAQAILITDNVEFGKAVEQAVERQLKTLNRAETAAA
SWRDFGAVILVADLKQAIPLANRIAAEHVELALADPDRLLDGIRNAGAIFIGAHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPAELRTLGPAAIALAVSEGLDAH
ARSVAIRLNLD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatctggctggatcaggcatcggaaggtttcgagcagcattttgccgcttttctg
acgacaaagcgcgaagtgtccgaggatgtgaacgccgtcgcccgcgctatcatcgatgat
gtcaggacgcgcggcgatgtggcgctggccgaatattcgctgaagttcgacggcatcgat
ttcgccgccgtgccgatgcgcgtgacgcctgaggagatcgacgccgcgatcgaggcggtg
cctgccgaagtgctgggggcgctgaagcttgcggcattgcgcatcgagagccatcatcgc
cggcagctgccgaaggacgatatctacgaggacgatctcggcgtcggtctaggctcgcgc
tggacggcgatcgaggcggtcgggctctatgttccgggcggcaccgcgagctatccgagt
tcggtgctgatgaatgcggtgccggcaaaggtcgccggcgttgagcgcgtcgtcatcgcc
gttcctgccacaggcggcgccgtcaatccggcggtgctcgccgccgccaggcttgccggt
gtgagcgagatctaccgcgtcggcggcgcccaggcgatcgccgctctcgcctatggcacc
gacacgatcgccccggtcgccaagatcaccggtcccggcaacgcctatgtcgccgccgcc
aagcgccatgtcttcggcaccgtcggcatcgatatgatcgccggcccctccgaggtgctg
gtgattgccgataaggacaacaatcctgattggatcgccgccgaccttttggcgcaggcc
gagcacgatgccagcgcccaggcgatcctgatcaccgataatgtcgaattcggcaaggcg
gtggagcaggcggtcgaacgccagctgaagacgctgaaccgcgccgagacggcagcggca
agctggcgcgatttcggcgccgtcatcctcgttgccgatctgaagcaagccattccgctc
gccaaccgcatcgcagccgagcatgtcgagctcgccctcgccgatcccgaccggctgctc
gacggcatccgcaatgccggcgcgatcttcatcggcgctcatacgcccgaggtcatcggc
gattatgtcgggggttcgaaccatgtgctgccgacagcgcgttcggcgcgcttctcctcc
ggtctttcggtgctcgatttcgtcaagcgcacctcgatcctgcgcctggggccggctgag
ttgcgcaccctcggcccggcggcgatcgcgcttgccgtctccgaaggtctcgatgcccat
gcgcggtcggtcgcgatccgcctcaacctcgattag

DBGET integrated database retrieval system