KEGG   Rhizobium etli CFN 42: RHE_CH00613Help
Entry
RHE_CH00613       CDS       T00317                                 

Gene name
rbsAch1
Definition
(GenBank) ribose ABC transporter, ATP-binding protein
  KO
K10441  
ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
ret  Rhizobium etli CFN 42
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00613 (rbsAch1)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     RHE_CH00613 (rbsAch1)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    RHE_CH00613 (rbsAch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
630836..632269
Genome map
AA seq 477 aa AA seqDB search
MRIGRGKGHVLLGENGAGKSTLINLLGGVFKPDDGHISFDGKPYHPGSPLEAFQAGIRVI
HQELHPLSNLTVAENLLFEHLPRRYGLVDYRKMNSRAAELLAEVGLDVAPTTLASRLSVA
QLQLLEIAKALCYESKLLVLDEPTATLTSKEVDRLFEILKRLKARGVTTLYISHRLEEIF
EVGDDVTVLRDGQRVITRPLSGLAIPDIVELMVGRTLSDHGIFRSDSAVFGEALGVSGLK
VTRNSPELSFSVAKGEIVGIAGLVGSGRTEAVRAIFGADAKAGGDIRVDGEPVEIKSPKD
AVAAGLCLATEDRKLQGLMLDMSCAQNATVTDFSKISRNGLIRRKVENEHAQRLVRELRI
KTPSIHQLVRTFSGGNQQKVVIAKWLFRGPKVLIFDEPTRGIDVGAKAEIYELLWKFAAE
GKGVLVVSSDLPELIGICHRIIVLSDGKIAGEIARDQFEESRILSLAYKEYSRVRQH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcggccgtggcaagggccacgttctcctcggcgagaatggcgcaggcaagtcg
accttgatcaacctgctgggcggcgtcttcaagccggatgacgggcacatttctttcgac
ggcaagccttatcatccgggctcgccgctggaagccttccaggcgggcattcgcgtcatc
caccaggaactccatcccctttccaatctcaccgtcgccgaaaacctgcttttcgagcat
cttccgcgccgatacggcctggtggactaccggaaaatgaacagccgcgcggctgaactg
ctggcagaagtcggcctcgacgtggcgccgacgacgcttgccagccgcctcagcgtcgcg
cagctgcaactgctcgagatcgccaaggcgctctgctatgaaagcaagctgctcgtcctc
gacgagccgacggcaaccttgacctccaaggaagtcgaccggctgttcgagatcctgaag
cggctgaaggcgcggggcgtgacgacgctttatatatcccatcggctcgaggagatcttc
gaagtcggagacgacgtcacggtgctgcgcgacggccagcgtgtcattacgaggccgctc
tccggattggcgatccccgatatcgtcgagctgatggtcggacgaacgctttcggatcat
ggtatctttcgcagcgacagcgccgtgttcggcgaggcgcttggcgtctccggcctgaag
gtgacacgcaacagcccggaactgtcgttctccgtcgccaagggagaaatcgtcggcatc
gccggtcttgtcggcagcggccgaacggaagcggtgcgcgccatattcggcgccgacgcc
aaggccggcggcgacatccgcgttgacggcgagccggtcgagatcaagtcgccaaaggat
gcggttgccgccggcctgtgcctggcgacggaagaccgcaagctgcagggtctgatgctc
gacatgagctgcgcgcaaaacgccaccgtcaccgatttcagcaagatctcccgtaacggg
ctaatcaggcggaaggtggagaacgagcacgcgcagcgtctcgtgcgcgagctgcgcatc
aaaaccccgtcgatccatcagctggtcaggacgttttccggcggcaatcagcagaaggtg
gtgatcgccaaatggctttttcgcggccccaaagtgctgattttcgatgagccgacccgc
ggcatcgatgttggcgccaaggcggagatctacgaacttctctggaagttcgccgctgaa
ggaaagggcgttctcgtcgtctcctcggacctgccggagctcatcggcatctgccatcgc
atcatcgtcctgtcggacggcaagatcgccggcgaaatagcgcgggatcaattcgaggag
agcaggatcctctcactcgcttacaaggagtacagtcgtgtccggcaacattga

DBGET integrated database retrieval system