KEGG   Rhizobium etli CFN 42: RHE_CH00628Help
Entry
RHE_CH00628       CDS       T00317                                 

Definition
(GenBank) putative transcriptional regulator protein, LuxR family
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 Sigma70_r4 HTH_40 HTH_23 HTH_10 HTH_38
Motif
Other DBs
NCBI-ProteinID: ABC89444
RhizoBase: RHE_CH00628
UniProt: Q2KCJ2
Position
648955..649659
Genome map
AA seq 234 aa AA seqDB search
MSNAAATPFHAGPELSRAINRTDFFRLLKAAAQHYHFDNFALARISEASAPFGERDIVIT
NVAERRVGLFIATLREALGTTRAKSAQFLATPVHGRSAQSDTYPSDLLFNEFRSGVFLFI
PLFTPEGRRYCLVLSGEREEPDQGEIADMLLDAMRIFDKLYEEILTPEMSGRLTQRESEI
VKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLVS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgccgcggcaactccttttcatgccggacccgaactgagccgggcgatcaac
cgcaccgattttttccgtctgctgaaagcagcagcgcagcattaccacttcgataatttc
gcgcttgcccgcatttccgaggcttcggctcccttcggcgagcgcgatatcgtcatcacc
aatgtcgccgagcgacgggtcggtcttttcattgcgacgttgagggaggcgctcgggacc
acccgggcaaagagcgctcagtttctggcaacgcccgtccatggcaggagcgcgcagtcg
gacacctatccctccgatctgcttttcaacgagttccgcagcggcgtcttcctcttcatt
ccgctgttcacgccggaagggcggcgatattgcctcgtgctgagcggcgagcgtgaggag
ccggatcagggcgagatcgccgacatgcttcttgatgccatgcgcattttcgacaagctg
tacgaggaaatcctaacgcctgagatgtccgggcggttgacccagcgcgaatcggaaatc
gtcaaatggaccagcgaaggcaagacctcggccgaaatcgccatcattctcggtctgtcc
gaacatacggtcaattcgcatatcactgcggccgcgcgtaagctcgacgccgtgaaccgc
gtccacatggtggcaatcgccctgagaaatggtttggtttcgtga

DBGET integrated database retrieval system