KEGG   Rhizobium etli CFN 42: RHE_CH00634Help
Entry
RHE_CH00634       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 Sigma70_r4 HTH_11 MerR HTH_23
Motif
Other DBs
NCBI-ProteinID: ABC89450
RhizoBase: RHE_CH00634
UniProt: Q2KCI6
Position
655983..656270
Genome map
AA seq 95 aa AA seqDB search
MVYLDQYGQPEIMGQGARETILTPALCRAARGLLDWTQADLAERAAVSRSTIRDYEGRRH
DIHRATEAQLRLAFEKGGVRFVEIEGAGTGLCLPD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggtctatctcgaccaatatgggcagccagaaatcatgggtcaaggcgcaagggaaaca
attctcaccccggctctctgccgcgcggcgcgcggcctgctggattggactcaggccgat
ctggccgaaagagccgccgtttcgcgcagcaccatccgcgattacgagggacgccgccac
gacatccaccgtgcgacggaggcgcagctgcgtctcgcattcgaaaagggaggtgtcagg
ttcgtcgagatcgaaggggcaggcaccggcctctgcctgcccgattga

DBGET integrated database retrieval system