KEGG   Rhizobium etli CFN 42: RHE_CH00635Help
Entry
RHE_CH00635       CDS       T00317                                 

Definition
(GenBank) putative glycosyltransferase protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2 P12
Motif
Other DBs
NCBI-ProteinID: ABC89451
RhizoBase: RHE_CH00635
UniProt: Q2KCI5
Position
complement(656286..657707)
Genome map
AA seq 473 aa AA seqDB search
MSPRSGLLIVFGFTLWRVVTLHFDATDLFVDEAQYWFWSQNLDLGYYSKPPMIAWVIRAM
TELSGSNAIYFIRLLGPLIHMAAALVLMKVAKRFVGPEIEGWTGATYITLPGVALSSVFF
STDVILLFFIAIALLAYFGLTQRRSVELALIMGLGVGLAFLTKYAVLFVVPGGAIALLLI
PSARIAVRDFIIAVAVAAVVALPNLWWNLQHDNTTVRHTQDIAHWSDIGINLRRGLEFFS
AQFGVVGPIIFFAMLWAVYRMIKGRSDDREKMLIWLSMPVVVLITLQATVAKAYANWAVT
AYVAGTILAVWLLYRMWPKGLRLSLTINGIASLLFPLATIFPQQLLLPNGDELMKRYLGR
AAVSREAGALAAQAGTDIIVTNNRDMVADLFYTLRDAPYRIYARAPAGLPESYYEQEFAL
PADVTGKVLFLTDVSLSCATETPEVLKNWQPTAGYYKGKALYIYKVSAGCLAP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccagatctggtctcctcatcgttttcggcttcacgctctggcgcgtcgtcaca
ctgcatttcgatgccacagacctgtttgtcgacgaggcacagtactggttctggtcgcag
aatctcgatctcggctactattcaaaaccgccgatgatcgcctgggtgatccgggcgatg
acggagctttccggctctaacgccatctatttcatcaggctgctcggaccgctgatccac
atggcggcagcactggtgctgatgaaggtggcaaaacggttcgtcgggccggagatcgaa
ggctggacgggcgccacctatatcacgttgccaggggtggcgctttcctcggtgttcttc
tcgaccgacgtgatcctgctgtttttcatcgcgatcgccctgctcgcctatttcggcctg
acgcagcggcgctccgttgaactggcgctcatcatgggcctcggcgtcggcctcgccttt
ctgacgaaatatgccgtgctattcgtcgtaccgggcggcgcgatagccctcctgctcatt
ccatcggcacgcatcgcagttcgggacttcatcatcgcggtcgcggttgcggcggtcgtc
gccttgccgaacctctggtggaacctgcaacacgacaatacgacggtgcgccatacgcag
gatatcgcccattggagcgacatcggcatcaatctgcgccgcgggctcgagttcttctcc
gcccaattcggcgtcgtcggaccgatcatcttctttgcaatgctctgggcggtctatcgc
atgatcaagggccggagcgatgaccgcgaaaagatgctgatctggctgtcgatgccggtg
gtggtgctgatcaccctgcaggcgaccgtcgccaaagcctatgccaactgggccgtgacc
gcctatgtcgctggcaccatccttgccgtctggctgctttaccggatgtggccgaagggg
ctaaggctgtcgctcaccatcaacggcatcgcaagcctgctctttccgctggcgaccatc
tttccgcagcaattgctgctgccgaacggtgacgaattgatgaagcgctatctcgggcgc
gccgcggtcagtcgcgaagcgggagcacttgcagctcaggccggcaccgacatcatcgtc
accaacaaccgcgacatggtcgccgatctcttctatacgctgcgcgacgcaccctaccgg
atctatgcccgggcgcccgcaggacttccagagagctattacgagcaggagttcgcgctg
cctgccgacgtcaccggcaaggtgcttttcctgacggacgtctccctcagctgtgccacg
gaaacaccggaggtactgaagaactggcagccgacggcgggctattacaagggcaaggcg
ctttacatctacaaagtctccgccggctgcctggcgccctga

DBGET integrated database retrieval system