KEGG   Rhizobium etli CFN 42: RHE_CH00645Help
Entry
RHE_CH00645       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABC89461
RhizoBase: RHE_CH00645
UniProt: Q2KCH5
Position
666380..666769
Genome map
AA seq 129 aa AA seqDB search
MTFTPVMEPPAPVEALSDLLMRIVSELHDVAYLIERIEPQLLDLGGAEILNSPDAMKVMQ
GIDLAVQKSRGLAEFIDTITGEIPLGWTVDVATALSLVKLAEMQKALGGSTRHGHSQPLS
KAAGDFDFF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacatttactccggtgatggagccgcccgcgcctgtcgaagcgctgagcgacctcctg
atgcgcatcgtttcggagctccacgatgtggcctacctgatcgagcgcatcgagccgcag
cttctcgatctcggtggcgctgaaattctgaactcgccggacgccatgaaggtcatgcag
ggcatcgatctggccgtgcagaagtcacgcggtcttgccgaattcatcgacaccatcacc
ggcgaaatcccgcttggctggacggtcgatgtcgcgaccgcgctcagcctcgtcaagctg
gcggagatgcagaaggcgctgggcggctccacgcgccacggtcattcgcagccgctgagc
aaggccgctggcgacttcgacttcttctga

DBGET integrated database retrieval system