KEGG   Rhizobium etli CFN 42: RHE_CH00647Help
Entry
RHE_CH00647       CDS       T00317                                 

Definition
(GenBank) probable transcriptional regulator protein, LuxR family
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
669143..669847
Genome map
AA seq 234 aa AA seqDB search
MANFASVVAPALLPRDELVRRLHGVADTGRLQSGLRALTDYVGASHYLLARCDLIQESGL
DFIVSSDWPFDLVRDIANDLVSTYARSTELEKCMQVFQPNFALLPEGADVPEGASRQYCS
LTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYIASFLRCGGAKVDRDFELTDRELE
CLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttcgcgagcgtggtggcgccggctctcttgccgcgcgacgagctggttcgg
cgcctgcatggtgtcgccgacaccggcagattgcagtccggtctgcgcgccctgacggac
tatgtgggtgcctcacactatcttctggcgcgctgtgatctcatccaggaaagcggcctc
gatttcatcgtatcgtctgactggccgttcgatctggttagggatatcgccaatgatctc
gtcagcacctatgcccgctcgaccgagctggaaaaatgcatgcaggtcttccagccgaat
ttcgcgctgctgcccgaaggtgccgatgtgccggagggtgccagccgccagtattgctca
ttgaccttcaatgtcggccgctcgcgcctcgccttgatgttcctgttcggcgaaggcttc
atcctgtcgccggagcgcctgcgggacgtgggactgcttgccggctacatcgcgagcttc
cttcgctgcgggggcgcaaaggtcgaccgcgatttcgaactgactgaccgtgagctggaa
tgcctgttctggatcgcggagggcaagaccagcgacgagatcgcgatgattctcggaata
tcccgcaataccatcaacaactacatcaccagcgtaatgcgcaagacggcgaccaagacc
cggtcggaggccattgccttcgcggtccgcaacaatctcgtatag

DBGET integrated database retrieval system