KEGG   Rhizobium etli CFN 42: RHE_CH00653Help
Entry
RHE_CH00653       CDS       T00317                                 

Gene name
fliM
Definition
(GenBank) flagellar C-ring protein
  KO
K02416  
flagellar motor switch protein FliM
Organism
ret  Rhizobium etli CFN 42
Pathway
Bacterial chemotaxis
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00653 (fliM)
   02040 Flagellar assembly
    RHE_CH00653 (fliM)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    RHE_CH00653 (fliM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(674113..675063)
Genome map
AA seq 316 aa AA seqDB search
MTMSDASHDKPAMDPALLAKLTGGLGDRGRVAKICSAFGDVYGEFLPDIIKSETGLDVTV
SYLGCEIGYKNHLVDDLSHNVTLVDATLRNWSQNVTLACGNGFVITLMEHLLGATADTIE
EPAERLLSVIELDLAVMVFDKIAKVLRSAVNAPGGFEPSLSAPHAHDARPRPAEDKPDEF
AAAINMSITLAGIVSEFSLIIPQTALLKTKVTPPKPKRQTGGNSPEWTEQLGDQVRRSHV
TLEAKIRLQDLTLRTISKLMAGDVIPFHDSGDVRVEVSANSKELYICEFGRSGENYMVRV
KDTMNSDDELIRHLMN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcgatgcttcgcatgacaaaccggcaatggatcccgcccttctcgccaag
ctgaccggcgggctcggagacagaggcagggtcgcaaagatctgcagcgccttcggagat
gtctacggcgagttccttcccgacatcatcaaaagcgagaccggcctcgacgtgaccgtc
agctatctcggctgcgagatcggctacaagaaccacctggtggacgacctcagccataac
gtcacgcttgtcgacgcgacgctgcgcaactggtctcagaacgtcacgcttgcctgcggc
aacggtttcgtcatcacgctgatggaacacctgctcggcgccaccgccgatacgatcgag
gagccggccgagcggctgctctcggtcatcgaactcgatctggcagtcatggtcttcgac
aagatcgccaaggtgctgcgctcggcggtgaacgcaccgggcggtttcgagcccagtctt
tcggccccgcacgcccatgacgcccgcccccggccggcggaggacaagccggacgaattt
gccgcagccatcaacatgtcgatcacgctcgccggcattgtttcggaattctcactgatc
attccgcagacggcgctgctcaagaccaaggtgacgccgccgaaaccgaagcgccagacc
ggcggcaattcaccggagtggaccgaacagctcggcgaccaggtccgccgctcgcatgtc
acgctcgaggccaagatcaggctacaggacctgacgctgcgcaccatatcgaagctgatg
gccggcgacgtcatcccgttccacgacagcggcgacgtacgcgtcgaggtcagcgccaac
agcaaggaattgtatatatgcgagttcgggcgttctggcgaaaactatatggtccgcgtc
aaggatacgatgaactcggatgacgaactcatccgtcatttaatgaattga

DBGET integrated database retrieval system