KEGG   Rhizobium etli CFN 42: RHE_CH00657Help
Entry
RHE_CH00657       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved membrane protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
678328..678870
Genome map
AA seq 180 aa AA seqDB search
MADFDDERIASLKQRNKTATLDRFLTFAGLALAGASAFFPWYVFFNADKFGINVASSSNS
RELPDWPARNVFSVSPLAMVNKNEAARKAPPVDPLTTATVSDLGKQRDGGAMLEEQPFPG
KSSFRLLHVSNGRALIEDPSGMYVVRIGSVLPDESRLAMIEQRDGKWVIITSKGDIYKND
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatttcgacgatgaacgcatcgcttccctgaagcagcgcaacaagaccgccact
ctggatcggtttcttaccttcgccggcctggcgcttgccggcgcctctgcctttttcccc
tggtacgtcttcttcaatgcggacaagttcggcatcaacgtcgcgagcagcagcaattcg
cgcgaactgccggattggcccgcccgcaacgtcttcagcgtctcgccgctggccatggtc
aacaagaatgaggcagccaggaaggctccgccggtcgatccgctgacgacggcgacggtc
tccgatctcggcaagcagcgtgacggcggcgcgatgctggaagagcagcctttcccgggc
aagtcttccttccgccttctgcacgtgtccaatggccgggcgctgatcgaagacccctcg
ggcatgtatgtggtgcgcatcggttcggtcctgcctgacgaaagccgcctggcaatgatc
gagcagcgcgatggcaaatgggtgatcatcacctccaagggcgatatctacaagaacgat
tga

DBGET integrated database retrieval system