KEGG   Rhizobium etli CFN 42: RHE_CH00660Help
Entry
RHE_CH00660       CDS       T00317                                 

Gene name
fliE
Definition
(GenBank) flagellar hook-basal body protein
  KO
K02408  
flagellar hook-basal body complex protein FliE
Organism
ret  Rhizobium etli CFN 42
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    RHE_CH00660 (fliE)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00660 (fliE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
679850..680191
Genome map
AA seq 113 aa AA seqDB search
MISSVQNVSNLSMTRALGAVDTENSASSAATTMPGTAGAANGLSFASVLGGMASDAVNSL
KGAESMSFAGIKGTATTREVVDSMLQAEQTLQTAIAIRDKVVSAFLEVTKMQM
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagcgtccagaatgtcagcaatctttcgatgacccgcgcgctcggcgccgtc
gacaccgaaaattccgcctcgtccgccgcaacgaccatgccgggcaccgcaggtgctgcc
aatggcctgagcttcgcctcggtcctgggcggcatggcgtccgacgcggtcaacagcctg
aagggtgccgaaagcatgtccttcgccggcatcaagggcacggcgacgacccgtgaagtc
gtcgattccatgctccaggccgagcagacgctgcagacggcgattgccatccgcgacaag
gtcgtttcggcctttctcgaagtcaccaagatgcagatgtaa

DBGET integrated database retrieval system