KEGG   Rhizobium etli CFN 42: RHE_CH00668Help
Entry
RHE_CH00668       CDS       T00317                                 

Definition
(GenBank) putative glycosyltransferase TPR domain protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_41
Motif
Other DBs
NCBI-ProteinID: ABC89484
RhizoBase: RHE_CH00668
UniProt: Q2KCF2
Position
complement(685189..686823)
Genome map
AA seq 544 aa AA seqDB search
MRNLTKAQEDAELAFIITAIYLKRQQRDIIRPFKTVLSESMNPDHMRLAALLLSDDLNDA
TNQSLARNIFKRFPGNHAFRFLHLVFAREFNDFEEAAKHQAVIDEALAKGNVEILRKDNP
FYHLHWCGNEDFNRYATIGTTPLNQERVALRRSQPHTWSNKIRIGYMSSDFWDRHATMKL
LQRILELHDKDRFEVTLFCHTGPEYLKHNETDRSRWGRIVDIHGFSDQAVLAVVREHNID
IMVDLKGHTSGSRATAFNQPLAPVHVGWLGFPGSTVNIDLDYVIGDHSVLPDVAKPFYHE
KFCRLPESYQPNDPMHRPKPRPVTREQLGLPEDAFIFASFNGNRKITPEVVNSWCRILKR
APNSVLWLMANSPRNQANLSKHFQTAGISPKRIIFCPRAPYEDHISRQQAADLGIDTFPV
NGHTTTSEQLWGGLPVLTVKGTNFASRVSESLLKAIDLPELVASDLQAYEDLAVELAQNP
ARIAEYKAHLKEQRYIAPLFDAERFCHHLEQAYEIMAERARQRLAPEHMDIPALPPRTAP
FAAE
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacctcaccaaagcgcaggaagatgccgaactcgccttcatcatcaccgcgatc
tatctgaagcgtcagcagcgggatatcatccgtccgttcaagacggtgctgtcggaaagc
atgaatcccgatcatatgcgcctggcggccctgctgctcagcgacgatctcaacgacgca
accaaccagtcgcttgcgcgcaacatcttcaaacgttttccgggcaatcacgccttccgc
tttcttcacctcgtttttgcccgcgaattcaacgatttcgaagaggcggccaagcatcag
gcagtgatcgacgaagcgctggcaaagggcaatgtcgagatcctgcgcaaagacaacccg
ttctatcatctgcactggtgcggcaacgaagatttcaaccggtatgcgacgatcggcacg
accccacttaatcaggagcgggtcgctttgcgccgcagccagccgcacacatggtcgaac
aagatccgcatcggctacatgtcatcggacttctgggatcgccacgcgacgatgaagctg
ctgcagcgcattctcgaactgcacgacaaggacaggttcgaggtcacgctcttctgccat
acgggccccgaatacctgaagcacaatgagaccgatcgcagccgctggggcaggatcgtc
gacattcacggcttctccgaccaggcggtgctggcagtcgtgcgcgagcacaatatcgac
atcatggtcgatctgaagggccatacgtcaggcagccgcgcgacagccttcaaccagccg
ctcgcaccggtgcatgtcggatggctcggttttcccggcagcaccgtcaacatcgacctc
gactacgtcatcggcgaccactccgtgctgcccgatgtggccaagccattctaccacgag
aaattctgccggcttccggagagctaccagcccaacgacccgatgcatcgtccgaagccg
cgccccgtcacccgtgagcagctcggcctgccggaagacgccttcatcttcgcctccttc
aacggcaaccgcaagatcaccccagaagtggtcaacagctggtgccggattctcaaacgg
gcgccgaacagcgtgctctggctgatggccaattcgccacgcaaccaggcgaacctgtcg
aagcatttccagacggcagggatctcgccgaagcgcatcatcttctgcccgcgcgcgccc
tacgaagaccacatcagccgccagcaggcggccgacctcgggatcgacaccttcccggtc
aacggccacaccaccacctcggagcagctctggggcggcctgccggtcctcaccgtcaag
ggcaccaacttcgcctcacgcgtcagcgaaagcctgctcaaggcaatcgatctgcccgaa
ctcgtcgcaagcgatctgcaggcatacgaggatctcgccgtcgagctggcgcagaatccc
gcccggatcgccgaatataaggcacatctgaaagagcagcgttacatcgcgccgctgttc
gacgccgaacgcttctgccatcacctggagcaggcctacgaaatcatggccgaacgggcg
agacagcgcctggcacccgagcacatggatattccggcgctgccgccgcgcacggctccc
ttcgcggccgagtaa

DBGET integrated database retrieval system