KEGG   Rhizobium etli CFN 42: RHE_CH00670Help
Entry
RHE_CH00670       CDS       T00317                                 

Gene name
flaCch2
Definition
(GenBank) flagellin C protein
  KO
K02406  flagellin
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02020  Two-component system
ret02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_CH00670 (flaCch2)
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    RHE_CH00670 (flaCch2)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00670 (flaCch2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C Matrilin_ccoil LXG
Motif
Other DBs
NCBI-ProteinID: ABC89486
RhizoBase: RHE_CH00670
UniProt: Q2KCF0
Position
688784..689692
Genome map
AA seq 302 aa AA seqDB search
MTSINTNNAAMAALQTLRGINQGLQTTQSHVSSGYRVGKAADNAAYWSIATTMRSDNKAL
SAVSDALGLGAAKVDTAYSAMDSAIDVVGDIKAKLVAATENGVDKAKVQEEISQLQQQLL
SIAQSASFSGENWVAGADGTKNVVASFVRDGSNAVSVVMTDYVLDDGSAGNVLFGMSNGA
VETSTGILGTSNGATGSVYAMDITNFTLGQIQTALTNVESALKSMTSAGAALGSISKRIE
LQENFVSALSDSIDSGIGRLVDADMEEESSKLSALQTQQQLAVQSLSIANSSSQTILSLF
RG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcatcaacaccaataatgctgcaatggcagcccttcagactctgcgcggcatc
aaccagggtctccagacaacgcagtcgcacgtttcgtccggttatcgcgtcggcaaggcc
gccgacaacgctgcctattggtcgatcgcaacgaccatgcgttcggacaacaaggcactg
tcggctgtttccgacgctctcggtctcggcgccgccaaggtcgacaccgcttactccgcc
atggacagcgccatcgacgtggtcggcgacatcaaggccaagctggttgccgcgaccgaa
aatggcgtcgacaaggccaaggtccaggaagaaatcagccagctgcagcagcagctgctc
agcatcgcgcagtcggcttccttctccggcgaaaactgggttgccggcgctgacggcacc
aagaacgtcgtcgcttccttcgtccgcgacggctccaacgccgtatcggtcgtgatgacc
gactacgttctcgacgacggctccgcaggcaacgttctgttcggcatgagcaacggcgcg
gtcgaaacctccacgggtatcctcggtacgtcgaatggcgcgacgggttcggtctacgcg
atggacatcaccaacttcaccctcggccagatccagaccgctctgaccaacgtcgaatcg
gctctgaagtccatgaccagcgccggcgctgctctcggctcgatctccaagcgtatcgaa
cttcaggaaaacttcgtctcggctctcagcgactcgatcgactccggtatcggccgtctc
gtcgacgccgacatggaagaagagtcctccaaactcagcgccctgcagacccagcagcag
ctcgccgtccagtcgctgtcgatcgccaactcctcttcgcagaccatcctgtcgctcttc
cgcggctaa

DBGET integrated database retrieval system