KEGG   Rhizobium etli CFN 42: RHE_CH00675Help
Entry
RHE_CH00675       CDS       T00317                                 

Gene name
motC
Definition
(GenBank) chemotaxis motility protein
  KO
K10564  chemotaxis protein MotC
Organism
ret  Rhizobium etli CFN 42
Brite
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    RHE_CH00675 (motC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABC89491
RhizoBase: RHE_CH00675
UniProt: Q2KCE5
Position
694260..695555
Genome map
AA seq 431 aa AA seqDB search
MARRQHRYVGFMALGLAMLSPAAGKAQDPDDLAPYKMLRSLQFVQDSVVAGDHSAGEMQR
FMLGTIDERLRTADTKIFDDDRNVDAALIYTMSGGNPQTLEYLIAHDVNGYFDNRVTDVL
RKYLTGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVMIATKPTDALDLYDQARLAAPG
TIVEEAALRRSLAICVDKGMLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDHDVK
PQDVVDILSFMDAPRQREVYLRIARAAAIAGKPELARMAVEHVQLLGAGTDNAFGPLADF
YGGMAGLPTDDIDQAAKNVSGIDGEALSPRDQALQAAARSVAEQILRAPDPASLTQASNP
NTSHQEITSEKAAAIATQPGTPGAPPEPVPGGVASTGQSQDTDSSFNAFVTTSRSKLDEI
DGLLAQEGNEQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtcggcagcatcgctacgtcggatttatggccctcggcctggcgatgctttcg
cctgccgcaggcaaagcgcaggatcccgacgatcttgcgccgtacaagatgctgcggtcg
ctgcagttcgtgcaggattccgtcgtcgctggcgatcattcggccggcgaaatgcagcgc
ttcatgctgggcaccatcgatgagcggctgcgaacggccgatacaaagatcttcgatgac
gaccgcaatgtcgatgcggcgctgatctacacgatgagcggcggcaatccccagacgctc
gaatatctaatcgcccatgacgtcaacggctatttcgacaaccgcgtcaccgatgtgctg
cgcaaatatctgaccggcaaggggctgctcgtcgctaagacgctggaggaaaccgccagg
gaatatcgcgacaagaagatcggtccatacctggcgctgatcggcggcaacgtgatgatc
gccacgaaaccgacagatgcgctcgacctctacgaccaggcacgtcttgccgcgccgggc
acgatcgtcgaggaggcggccttgcgccgttccctcgccatctgcgtcgacaagggaatg
ctcgacaaggggctcgcctattcccagcgttatgccagacgcttcctgcattcgccctat
gccagccagttcgccgatctcttcgtcaagctcgtcgtcgcccatgatcacgacgtgaaa
ccgcaggatgtcgtcgatatcctctccttcatggatgccccgcgccagcgcgaggtctat
ctgcgcatcgcccgcgctgccgcgatagcgggcaagcccgagctggcgcgcatggcggtc
gaacatgtgcagttgcttggcgcgggcaccgacaatgccttcggcccgctcgcggatttt
tatggcggcatggccggccttcccacggacgatatcgaccaggcggcgaagaatgtcagt
ggcattgacggcgaagcgctttcgccgcgagatcaggcgctgcaggcggcggcgcggtcc
gttgccgaacagattctgcgtgcgccggacccggcaagcttgacgcaagcatccaatcct
aacacttctcatcaagaaatcacttctgaaaaggctgcggcgatagccacgcaaccgggg
acgccaggtgcgcctcccgagcctgttccgggaggtgtggcatcgactggccagagccag
gataccgactcctcattcaacgcatttgtgacgaccagccgatccaagctcgacgagatc
gatggtcttctggcgcaggaaggcaacgaacaatga

DBGET integrated database retrieval system