KEGG   Rhizobium etli CFN 42: RHE_CH00681Help
Entry
RHE_CH00681       CDS       T00317                                 

Gene name
flgLch
Definition
(GenBank) flagellar hook-assosiated protein
  KO
K02397  
flagellar hook-associated protein 3 FlgL
Organism
ret  Rhizobium etli CFN 42
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    RHE_CH00681 (flgLch)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00681 (flgLch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
701381..702433
Genome map
AA seq 350 aa AA seqDB search
MKSSFISSSAIQNAMRLTIRQAQNQMTKATMEATTGVYADIGVSLGGNAARSVDFTRETD
RIDSIKSSNSLVTARMESSQLGLSKMKDVGDGLVSKLTALQGSHDPGSITVAIQSATSAL
STMMDTANTVVNGEYLFSGINTDVQPLTDKTTATSAAIVTALNTYAAGLVPPKAVSDLTG
AEMSTFITTTVEPMFSEASWTNTTTGWSQASSQNMTSRISNSEVIESSTNANSEGMRYMA
LASVMTTALLGQNLSTDAMTTVSKQAISYTAKATSGLVTQASQLGLSQERVKKSNDALDA
QSNIIKNKLVDLQGVDPYEASTLVKTLETQLETAYTIVSKIQQLSLVNYL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctcatttatttcaagttcggccattcagaatgcgatgcggttgacgatccgt
caggcgcagaaccagatgacgaaggcgacgatggaagcgacgaccggagtctacgcggat
atcggtgtttcgctgggaggcaatgccgccagaagcgtggatttcacccgcgagaccgac
cgaatagactcgatcaaatcaagcaattcgctcgtcaccgcgcgcatggaatcctcgcag
ctcggcctttccaagatgaaggatgtcggcgacggcctcgtgtcgaagctgaccgcgctc
cagggaagccatgatcccggcagcatcaccgtcgccattcagtcggcgaccagcgcactg
tcgaccatgatggatacggccaacaccgtggtgaacggggaatacctgttctccggcatc
aataccgacgtgcagccgctgaccgacaagacgaccgccacgagtgcggcgatcgttacc
gccctgaacacctatgcggccggtcttgtcccgccgaaagcggtcagcgatctcacgggc
gccgagatgagcactttcatcacgacgacggttgagccgatgttcagcgaagcgagctgg
accaacacgacgaccggctggtcgcaggcatcaagccagaacatgacgagccgcatcagc
aactcggaagtgatcgagtcctcgaccaatgccaattccgaaggcatgcgctatatggcg
ctcgcctcggttatgaccaccgcgctgctcggccagaacctcagcaccgatgcaatgacg
acggtgtccaagcaggccatcagctacacggcgaaggccacgagcggtctcgtgacacag
gcaagccagctcggcctctcgcaggagcgcgtcaagaagtccaacgacgctctcgacgcc
cagtcgaacatcatcaagaacaagctggtcgatcttcagggcgtcgacccgtacgaagcc
tcgaccctcgtcaagactttggaaacgcagcttgaaaccgcttacacgatcgtctcgaag
atccagcagctgagtctcgtgaactacctttga

DBGET integrated database retrieval system