KEGG   Rhizobium etli CFN 42: RHE_CH00683Help
Entry
RHE_CH00683       CDS       T00317                                 

Gene name
flbT
Definition
(GenBank) flagellin synthesis regulator (repressor) protein
  KO
K06601  
flagellar protein FlbT
Organism
ret  Rhizobium etli CFN 42
Brite
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00683 (flbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
702814..703263
Genome map
AA seq 149 aa AA seqDB search
MKSTLRISLKAGERIFINGAVLRVDRKVALEFLNDVTFLLENHVLQPEGATTPLRQLYFI
AQMILINPEGKDHSTAMFRKSITMLLTCFKNEEILAELKRIDALVSTGRAFDALKAIRGL
YAIEDNILNNQELPPTMVEQIRREIAPWR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcacacttcgcatttctctgaaagccggagaaagaatcttcatcaacggcgcc
gtcctgcgtgtcgaccgcaaggtcgcgctggaattcctgaatgatgtgacgttccttctc
gagaaccacgtcctccagccggaaggcgcaacgacgcccctgcgccagctctatttcatc
gcgcagatgatcctcatcaatcccgagggcaaggaccactcgacggcgatgttccgcaag
tcgatcaccatgctgctcacctgcttcaagaacgaagagatcctcgcggaactaaagcgg
atcgacgcgcttgtgtcgaccggccgcgccttcgacgcattgaaggccatccgcggtctc
tacgcgatcgaagacaacatcctcaacaatcaggaactgccgccgacgatggtcgagcag
attcgcagggagatcgcaccatggcggtag

DBGET integrated database retrieval system