KEGG   Rhizobium etli CFN 42: RHE_CH00684Help
Entry
RHE_CH00684       CDS       T00317                                 

Gene name
flgD
Definition
(GenBank) flagellar basal-body rod protein
  KO
K02389  
flagellar basal-body rod modification protein FlgD
Organism
ret  Rhizobium etli CFN 42
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ret00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    RHE_CH00684 (flgD)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    RHE_CH00684 (flgD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
703254..703682
Genome map
AA seq 142 aa AA seqDB search
MAVDATSSVTSSTSTSSSSSAQSKATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLAT
FSQVEQTIQTNTKLDTLLASSSLTQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTT
DGDKILVQAGITVADEAPSSSS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagacgcaacgtcaagcgtgacgagctcgacctcgacgagctcgtcgagctcg
gcccagagcaaggcgacgcttaactacgataatttccttcagctgctcatcgcgcagatg
aagaaccaggatccgaccgatccgatggatgcaagcgagcaggtcgctcagctggccact
ttctcgcaggtcgagcagacgattcagaccaacaccaagctggatacgcttctggcaagt
tcgagcctgacccaggcgagcagctatgtcggcaaatatatggaaagcgccgacggcacc
gtcaaaggcgtcatcgattccgtcaaggtttattccgacggcatcattgcgacgaccacg
gatggcgataagatactcgtgcaggcgggaatcactgttgccgacgaggcgccgagcagc
agctcctga

DBGET integrated database retrieval system