KEGG   Rhizobium etli CFN 42: RHE_CH00688Help
Entry
RHE_CH00688       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRP_2
Motif
Other DBs
NCBI-ProteinID: ABC89504
RhizoBase: RHE_CH00688
UniProt: Q2KCD2
Position
707018..707431
Genome map
AA seq 137 aa AA seqDB search
MIEKSRSQKLKRLLSVQRHIERMAENDLAETSRQRIEVNAAMDDVIVALGSMDPVHHAFS
QNYADRFGRLTIKDQQLTGMQQIHEMRLSRERAKADRLEEGMKGALDAERREADDNAVYD
VIDQQFATPASSKLQKP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagaagagccgctcccaaaaactcaaacgtctgctgtcggtgcagcggcatatc
gagaggatggcggagaacgacctggccgaaaccagccgtcagcgcatcgaggtcaatgcg
gcgatggacgacgtcatcgttgctctcggttcgatggacccggtccaccacgccttctca
cagaattatgccgaccgattcggcaggctgacaatcaaggatcagcagctgaccggcatg
cagcagatccacgagatgcggctgtcgcgcgagcgcgccaaggccgatcggctggaagaa
ggcatgaaaggggccttggacgccgagcgccgcgaggccgacgacaatgctgtttacgat
gtaatcgaccagcaattcgcaacgccagcctccagcaagcttcaaaaaccataa

DBGET integrated database retrieval system