KEGG   Rhizobium etli CFN 42: RHE_CH00689Help
Entry
RHE_CH00689       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
707463..708026
Genome map
AA seq 187 aa AA seqDB search
MAISPPSDLVLDVVKAADPMEVQAAQEKLKANRAAFAATSLAENGKGFSNTVDVLDHIGQ
KSGLSHIQNRTKTEEVPESYRKFEAMVLQNFVKSMLPSESEDVYGKGATGDIWKGMMAEQ
LGNTMAKGDGIGIAKQMYSEQLRRQEGKIVNASTDDRDRNTALSMIDDFQRKTFGTPTAD
AKTDRTG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtggctatttcgccccccagtgatctggtcctggacgtggtcaaagctgccgaccccatg
gaggttcaggcagcccaggaaaaattgaaggcaaatcgtgcggcctttgccgcgacgagc
ctcgccgagaacggcaagggcttctccaatacggtcgacgttctcgatcatatcggccag
aagagcggcctctcccatattcagaaccgcaccaagaccgaggaggttccggaaagctac
cggaagttcgaggccatggtgctgcagaacttcgtcaagtcgatgctgccgagcgagagc
gaagacgtttacggcaagggcgcgaccggcgatatctggaagggcatgatggccgagcag
ctcggcaacaccatggccaagggcgacggcatcggcatcgccaagcagatgtacagcgag
cagctgcgccgtcaggaaggcaagatcgtcaacgcttcgaccgatgatcgtgaccgcaac
accgcgctcagcatgatcgacgacttccagcgcaagacctttggcacgccgacggcggac
gccaagaccgatagaacaggatga

DBGET integrated database retrieval system