KEGG   Rhizobium etli CFN 42: RHE_CH00690Help
Entry
RHE_CH00690       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAM198
Motif
Other DBs
NCBI-ProteinID: ABC89506
RhizoBase: RHE_CH00690
UniProt: Q2KCD0
Position
708151..708516
Genome map
AA seq 121 aa AA seqDB search
MEIISNEYRIKSVLGRLEMIIDNENTRIGNDPQFDLKVSNAHKSRCLYELSMLFRDTDPA
ELAASHLDQLHGLKKKLVLNARRVEAHLEAVRAVADLLKNAVQDADADGTYSQEQFAARG
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaataatttcgaacgaatacaggatcaaatccgtcctcggacgcctcgagatgatc
atcgacaatgagaatacccggatcggcaacgatccgcagttcgatctcaaggtctccaat
gcgcataagagccgctgcctctacgagctgtcgatgcttttccgcgataccgatccggcc
gagcttgccgcttcccacctcgatcagttgcacggcttgaagaagaagctggtgctcaac
gcccggcgcgtcgaagcgcatctcgaagcggttcgtgccgtggccgacctcctgaagaat
gcggttcaggacgccgacgccgacggcacctattcccaggaacaattcgccgcgcgtggg
aactga

DBGET integrated database retrieval system