KEGG   Rhizobium etli CFN 42: RHE_CH00698Help
Entry
RHE_CH00698       CDS       T00317                                 

Gene name
aglG
Definition
(GenBank) alpha-glucoside ABC transporter, permease protein
  KO
K10234  alpha-glucoside transport system permease protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
Module
ret_M00201  alpha-Glucoside transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00698 (aglG)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   alpha-Glucoside transporter [MD:M00201] [OT]
    RHE_CH00698 (aglG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABC89514
RhizoBase: RHE_CH00698
UniProt: Q2KCC2
Position
717028..718191
Genome map
AA seq 387 aa AA seqDB search
MTAVGNYFKIGPARLFVHLAVLLIVIIWLIPTLGIFVSALRDKDQIVVSGWWTAFVGSTQ
TVAVRLGTPDQQKQEGANYVITGNVLEGQTGRSVKAFGNRVQQPAAFEAGETADLGDGES
LQINSDGSYRYMKNTAFSPDERPRRIYASVSAPPEFTLQNYKTVLTGEGIGQSFINSLTV
TIPATIIPILIAAFAAYALSWMEFPGRALLIALVVGLIVVPLQMSLIPLLRLYNEIGNML
GQPSKTYPGIWFAHTAFGMPLAIFLLRAYIAGLPKEIIESARVDGASDFEIFVRIVLPLS
FPALASFAIFQFLWVWNDLLVAMVFLGTDQDHLVLTGRLNALLGSRGGNWEILTASAFVT
IVVPLLVFFGLQRYLVRGLLAGSVKGG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtcggaaattacttcaagatcggccccgcccgtctcttcgttcaccttgcc
gttctgctgatcgtcatcatctggctcatcccgacgctcggcatctttgtcagcgccctg
cgcgacaaggaccagatcgtcgtctccggctggtggacggcctttgtcggctcgacacag
acggtcgccgtccgcctgggcacgcccgaccagcaaaagcaggaaggcgccaactacgtc
atcacaggcaatgtgctggaagggcagaccggccgctcggtcaaggcgttcggcaaccgc
gtgcagcagccggccgctttcgaagccggcgagaccgccgatctcggcgacggcgaaagc
ctgcagatcaacagcgacggcagctaccgctacatgaagaacacggccttttcgcctgac
gagcggccgcggcgcatctacgcgtccgtctcggcgccgccggaattcacgctgcagaac
tacaagacggttctgaccggcgaaggcatcggccagtccttcatcaattcgctgacggtg
acgatcccggcgacgatcatcccgatcctgattgccgcttttgccgcctatgccttgagc
tggatggagtttcccggtcgcgcgctgctgattgcgctcgtcgtcggcctcatcgtcgtg
ccgctgcagatgtcgctgattccgctgcttcgcctctacaacgagatcggcaatatgctc
ggccagccgtcgaagacctatcccggcatctggtttgcgcacaccgccttcggcatgccg
ctcgccatctttctcctgcgggcctatattgccggcctgccgaaggagatcatcgaatcc
gcccgcgtcgacggcgcaagtgacttcgagatcttcgttcgtatcgttttgcccttgtcc
ttcccggcactcgcttcctttgccatcttccagttcctgtgggtatggaacgacctgctc
gtcgccatggtcttcctcggcaccgaccaggatcacctcgtgctgaccggcaggctgaac
gcgctgctcggctcgcgcggcggcaattgggagattttgacggcgtcggccttcgtcact
atcgtcgtgccgctgctcgttttcttcggactgcagcgttatctggtgcgtggtctgctg
gcgggttcggtcaagggcggctga

DBGET integrated database retrieval system