KEGG   Rhizobium etli CFN 42: RHE_CH00710Help
Entry
RHE_CH00710       CDS       T00317                                 

Definition
(GenBank) probable transcriptional regulator protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_45
Motif
Other DBs
NCBI-ProteinID: ABC89526
RhizoBase: RHE_CH00710
UniProt: Q2KCB0
Position
735479..736234
Genome map
AA seq 251 aa AA seqDB search
MLDLEQDVGRALFSRSQTGYRLTQDGQALLDHLQEMEAAARKVEAWRQSGEGGTTVRITT
GTWLAWLLTENFAAIRMPGDGFAIALSIGEARASLAYRESDIGIRAFEPEEANLAARLLG
EVAYAVYARRNAAETDERWIAVGEEEAISAYLRWPHAHAAANIVATVNRPRSLPDLVRAG
AGKTVLPCFVGDLHPELQRQGGELPELRHRQWIVMNAEDRHRPEIRTVADRMTKLIRSYA
DLFAGKRPSRG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctcgaacaggatgtcggccgcgccctgttttcgcgcagccagaccggttac
cggctgacgcaggatggccaggcgctgctcgaccatcttcaggagatggaagccgccgcc
cgcaaggtggaggcctggcggcaatccggtgagggcggcacgaccgtcaggatcaccacc
ggcacctggctcgcctggctgctgaccgaaaatttcgccgcgatccgcatgccgggcgat
ggcttcgccattgcgctctccattggcgaggcgcgggcgagccttgcctatcgtgagagc
gatattggcattcgtgccttcgagccggaggaggccaatctggccgcacgcctgctcggg
gaggtggcctatgctgtctatgccaggcgcaacgccgccgagaccgacgagcgctggatt
gccgtcggcgaggaggaggcgatatcagcctatctgcgctggccgcacgcccatgccgct
gctaacatcgtcgccaccgtcaaccggccgcgttcgctgccggacctggtgcgcgccggc
gccggcaagaccgtgcttccttgtttcgtcggcgatcttcatccggaattgcagcgccag
ggcggcgaactgccggaactgcgtcaccgccaatggatcgtcatgaatgccgaggatcgc
catcgtccggagatccgcacggtcgccgaccgcatgaccaagctcatccgaagctatgcc
gatctcttcgccggcaagcgcccgagccgcggttga

DBGET integrated database retrieval system