KEGG   Rhizobium etli CFN 42: RHE_CH00712Help
Entry
RHE_CH00712       CDS       T00317                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00630  Glyoxylate and dicarboxylate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Module
ret_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHE_CH00712 (aceA)
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RHE_CH00712 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABC89528
RhizoBase: RHE_CH00712
UniProt: Q2KCA8
Position
complement(736579..737868)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNAPAGRFDGIERPYSAADVQRLRGSVALTHTLAEMGADRLWRLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQVETSEGNGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLEQARRFAEGVHNI
HPGKLLAYNCSPSFNWKKNLEEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQEAEFAAEDYGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHDSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttttacaagcttgttcccaatgcaccggcgggccgcttcgacggcatcgaa
aggccctattcggccgccgacgtgcagcggctcagaggctcggtggcgctgacccacacg
ctggccgaaatgggggcggatcggttgtggcggctgctgcaccaggaggacttcgtcaat
gcgctcggcgcgctctccggcaaccaggccatgcagatggttcgcgccgggctgaaggcg
atctacctctccggctggcaggtggcggccgacgccaatacggcatcggcgatgtatccc
gaccagtcgctttatcccgccaatgccgggccggagctagccaaacgcatcaaccgcacg
ctgcagcgcgccgatcaggtcgagacatcggaaggaaacgggctttccgtcgagacctgg
ttcgcgccgatcgtcgccgatgcggaagccggtttcggtgggccgctcaacgccttcgag
atcatgaaggcctatatcgaggcgggtgcggcgggcgtccatttcgaggaccagctcgcc
tcggaaaagaaatgcggccatctcggcggcaaggtgctgatcccgacggccgcccatatc
cgcaacctcgacgccgcacggcttgccgccgacgtcatgggcgtggcgacgctggtgatc
gcccgcaccgacgcggaagcggcaaagctcttgacctccgacatcgacgagcgcgaccag
cccttcgtcgattacgatgccgggcgaacggtcgaaggcttctaccaggtcaggaacggc
atcgagccgtgcatcgcccgggccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacttccaaaccggatctcgagcaggcgcgccgctttgccgagggcgtgcacaatatc
catcccggcaagctgctcgcctataattgctcgccttcgttcaattggaagaagaacctc
gaggaggcgacgatcgccaggttccagcgcgaactcggggcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgaactggcgcgcggc
tatcggcagcggcagatgtcggcctattccgagctgcaggaggcggaattcgccgcggag
gactacggctataccgcgaccaaacatcagcgcgaggtaggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcgtcgaccaccgccatgcacgattcaaccgaa
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system