KEGG   Rhizobium etli CFN 42: RHE_CH00713Help
Entry
RHE_CH00713       CDS       T00317                                 

Definition
(GenBank) putative transcriptional regulator protein
  KO
K07110  
XRE family transcriptional regulator, fatty acid utilization regulator
Organism
ret  Rhizobium etli CFN 42
Brite
Transcription factors [BR:ret03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    RHE_CH00713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
738061..739470
Genome map
AA seq 469 aa AA seqDB search
MAERKIFAGPKLRRIRNALALTQTAMAEALEISPSYLNLIERNQRPLTVQLLLKLAAVYR
VDLEELRGQTGGSLGQLKEVFADPLLAGELPGDQELVEVAEAAPNAAAGMIKLYRAYREQ
AARLSDLTALMAAEGHTPIAASRLPLDELRETLERRPAYFGRIETAAEAFAATLPGGVDL
AAGLKDWLRAERGIAVRVLPVHVMPDLRRRFDRHSMRLFISERLSPADRAHEIAIETANL
ALLPAIDAELDDLSLSSAEARRIARFELARIAALALAMPYEAFLAAAKATRYDIDILRAR
FGVSFGHAATRLTMLQRPGAAAIPFFMMEIDAAGYRLRRGGAQGFPQARFGGGCPKLNIH
AAFLQPGQILAETVIMPDGASFLTVARTLEGPSVEFGERVRRTAMLIGCDAALSDGLAYG
QMTAVDPVTIGPACRLCERRGCLSRAEAPVTRPLGLDEMVAGLSAFDFQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacggaagatattcgcaggcccgaaattgcggcgcatccgcaatgcgctggcg
ttgacgcagaccgccatggccgaggcgctggagatttcgccctcttatctgaaccttatc
gagcgcaaccagcggccgttgacggtgcagctgctcttgaagctcgcggcagtctaccgg
gtcgatctggaggagttgcgcgggcagaccggcggcagcctcggccagctcaaggaggtc
tttgccgatccgctgcttgcaggcgaattgcccggcgaccaggaactggtggaagtggcc
gaggccgcacccaatgccgcggccggcatgatcaagctttatcgcgcctatcgcgagcag
gccgcccggctgtcggacctgacggcgctgatggcggccgaagggcacacaccgatcgcc
gccagccggttgccgctcgacgagctgcgcgagacgctggagcgcagaccggcctatttc
ggccggatcgagacggcggcggaagcctttgccgcgacgcttcccggcggcgtcgacctt
gccgcagggctgaaggactggctgcgggccgagcgcggcattgcggtgcgcgtcctaccg
gtgcatgtcatgccggatctacgccgccgtttcgaccggcattcgatgaggcttttcatt
tccgagcgcctgtcgccggccgaccgtgcgcacgagatcgctatcgagacggccaacctc
gctttgctgccggctatcgatgccgagctcgacgatctctcgctctcctccgccgaggcg
cgccgcatcgcccgcttcgagctggcccgcatcgcggccctggcgctcgccatgccctat
gaggccttcctggcggcggcgaaggcgacgcgctacgatatcgacattctgcgcgcccgc
ttcggcgtttctttcggtcatgcggcgacgcgtctgaccatgctgcagcggccgggggcg
gcagccatccccttcttcatgatggagatcgatgccgccggctaccggctgcggcgaggc
ggcgcccagggctttccgcaggcccgcttcggcggcggctgtccgaagctcaatatccac
gccgccttcctgcagcccggtcagattctcgccgagacggtcatcatgccggacggcgca
tccttcctgacggtcgcccgcacgctcgagggaccgagcgtcgaattcggcgaaagggtc
aggcgcacggcgatgctgatcggctgtgatgccgccctttcagacggcctggcctacggg
cagatgacggcggtcgatccggtcacgatcggcccggcctgtcgcctctgcgagcggcgc
ggctgcctctcccgcgccgaggcgccggtgacgagaccgctcgggctcgacgagatggta
gcgggcctcagcgccttcgacttccagtga

DBGET integrated database retrieval system