KEGG   Rhizobium etli CFN 42: RHE_CH00714Help
Entry
RHE_CH00714       CDS       T00317                                 

Gene name
potF
Definition
(GenBank) spermidine/putrescine ABC transporter, substrate-binding protein
  KO
K11073  putrescine transport system substrate-binding protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
Module
ret_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00714 (potF)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    RHE_CH00714 (potF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11 OpuAC Lipoprotein_8
Motif
Other DBs
NCBI-ProteinID: ABC89530
RhizoBase: RHE_CH00714
UniProt: Q2KCA6
Position
739595..740692
Genome map
AA seq 365 aa AA seqDB search
MRSTIANVTAAAIAALFAAAPAVAQERVVNVYNWSDYIDDSILADFTKETGIKVVYDTFD
SNETVETKLLAGGTGYDVVVPTADFLQRQIQAGVFQKLDKSKLPNLSNMWDVIQQRTAAY
DPGNEYAVDYMWGTDGIGYNVKKVAEILGPDAKPGLEVIFDPKVAEKFKDCGIYVLDTPK
DVMTTALKYLGLDPNSTKAEDFKKVEELLTAVRPYIRKFHSSEYINALANGDICIAFGYS
GDMLQARDRAAEAKNGVEVNYSIPVQGAQMWFDMMAIPADAKHVAEAHEFLNYMMRPEVI
AKASDHTFYANGNKASQQFVSKEVLEDPAVYPTDEVMKGLFTVKPWDPKTQRTATRIWTK
VVTGQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcaaccatcgcaaatgtgacggccgccgcaatcgccgcgctctttgccgccgct
ccggcggttgcgcaggagcgcgtcgtcaacgtctacaactggtcggattatatcgacgac
agcatccttgccgatttcaccaaggaaaccggcatcaaggtcgtctacgacacattcgat
tcgaacgagaccgtcgaaaccaagctgctcgccggcggcaccggttatgatgttgtcgtt
cccaccgccgacttcctgcagcgccagatccaggccggcgtcttccagaagctcgataag
tcgaagctgccgaacctctccaacatgtgggacgtgatccagcagcgcaccgccgcatac
gatccaggcaatgaatatgcggtcgattacatgtggggcaccgacggaatcgggtacaac
gtcaagaaggttgccgagatcctcggccccgatgccaagccgggcctcgaagtgatcttc
gatccgaaggtcgccgaaaagttcaaggactgcggcatctacgtgctcgacacgccgaag
gacgtcatgaccacggcgctgaaatatctcggcctcgatccgaactccaccaaggccgaa
gatttcaagaaggtcgaggaactgctgacggcggtccgcccctatatccgcaagttccat
tcctccgaatatatcaacgcccttgccaatggcgacatctgcatcgccttcggctattcc
ggcgacatgctgcaggcccgcgaccgcgccgccgaagccaagaacggcgtcgaggtcaac
tattcgatccccgtgcagggcgctcagatgtggttcgatatgatggcgatccccgccgat
gccaagcatgtggccgaagcgcatgagttcctgaactacatgatgaggcccgaagtcatc
gccaaggcgagcgaccacaccttctatgccaacggcaacaaggcctcgcagcaattcgtc
agcaaggaggtgctcgaagatccggcggtctacccgacggacgaggtgatgaaaggactc
ttcaccgtcaagccgtgggacccgaagacccagcgcacggcgacgcggatctggaccaag
gtcgtcaccggccagtaa

DBGET integrated database retrieval system