KEGG   Rhizobium etli CFN 42: RHE_CH00717Help
Entry
RHE_CH00717       CDS       T00317                                 

Gene name
potI
Definition
(GenBank) spermidine/putrescine ABC transporter, permease component II protein
  KO
K11074  
putrescine transport system permease protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ABC transporters
Module
Putrescine transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00717 (potI)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    RHE_CH00717 (potI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
742846..743664
Genome map
AA seq 272 aa AA seqDB search
MLRWTRFNIISVVLGFAFLYLPIVLLVVFSFNESKLVTVWGGFSAKWYVSLLSNQALLDA
AWVTIRVGLLSATFATILGTMAALTLVRYTRFRGRMLFSGMVYAPLVMPEVITGLSLLLL
FVAIGFDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDQSIEEAAQDLGAPPVRTFFEITL
PIISPAVFSGWILAFTLSLDDLVIASFTSGPGATTLPMKIYSQVRLGVTPEINAICTILI
AIVAVGVICASIVTKRREVQRERDERAAAAGA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgagatggacccgtttcaacatcatctccgtcgtgctcggctttgccttcctctat
ctgccgatcgtgctgctggtggttttttccttcaacgaatcgaaactcgtcaccgtctgg
ggcggcttctccgccaaatggtatgtctcgctgctctcgaaccaggccctgctcgatgcc
gcctgggtgacgatccgtgtcggtctgctgtcggccaccttcgcgaccatcctcggcacg
atggcggcgctgacgctggtgcgctatacccgcttccgcggccgcatgctcttttcaggc
atggtctatgcgccgctcgtcatgccggaagtcatcaccggtctgtcgctgctgctgctc
ttcgtggcgatcggcttcgaccgcggcttttggacgattacgctggcgcatacgacgctg
accatgtgcttcgtcgccgtcgtcgtgcaatcacggctcttaagcttcgatcagtcgatc
gaggaagccgcgcaggatctgggcgcgccgccggtgcgcaccttcttcgagatcacgctg
ccgatcatctcgccggcggtgttttcgggctggatcctggctttcacgctttcgctcgac
gacctcgtgattgcaagtttcacctccggccccggcgcaaccacgctgccgatgaagatc
tatagccaggtgcgccttggcgtgacgcccgagatcaatgcgatctgcacgatcctcatc
gccattgtcgcagtcggcgttatctgcgcatcgatcgtcaccaagcggcgcgaagtgcag
cgcgagcgcgacgagcgggcggccgccgccggcgcctga

DBGET integrated database retrieval system