KEGG   Rhizobium etli CFN 42: RHE_CH00723Help
Entry
RHE_CH00723       CDS       T00317                                 

Definition
(GenBank) probable metallopeptidase protein
  KO
K01406  
serralysin [EC:3.4.24.40]
Organism
ret  Rhizobium etli CFN 42
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ret00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    RHE_CH00723
Enzymes [BR:ret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     RHE_CH00723
Peptidases [BR:ret01002]
 Metallo Peptidases
  Family M10
   RHE_CH00723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
753388..754377
Genome map
AA seq 329 aa AA seqDB search
MTDLITPTKTVDVTRDQKVDGLFSGTAWDGTITYAFPTTSSSYADGAELYYEKYYSFSPI
SSQQQSLALYFMEQSYGSAANDGFSVEGFTNANFEAGSANTATVRFAQTSDPLLDTAGAY
FPATDGRGGDIWFGTGYAGTEADYRFPRFGNYAGQTLAHELGHALGLKHAHEGGTVVPSA
YDSLEYTIMTYHTFIGDDESGAKYEQNGAPQTFMMLDIAALQEMYGADYTTNSGDTVYRW
NPNQGITYVNGVAAITPAANRVFATIWDGGGTDTYDLSAYTTALKIDLHAGGYSVFPRVS
WPIWAAVRMMAMPAATFSTPFFITTMSRR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccttattactccgacgaagaccgtagacgtgactagggatcagaaggtagac
gggctcttcagcggcactgcctgggacggaacgataacctatgcgtttcccacgacctcg
tcatcgtatgccgatggcgccgaattatactacgaaaaatactattcattctctcctatt
tcgtcgcagcagcagtctctcgccttgtactttatggagcaatcctacgggagtgcggca
aatgacggcttctccgtcgaggggttcacgaacgctaactttgaggccggaagcgcgaat
accgcaacggtgcggttcgctcaaacgtcggatcccttgctggatacggcaggggcctat
ttcccagccacagacgggcggggtggcgatatctggttcgggacgggatatgctggcacc
gaagctgattatcgcttcccgaggttcggcaactatgcgggccaaaccttggcgcacgag
ctgggtcacgcgctcggactaaaacatgctcacgaagggggaacggtcgttccaagcgcc
tacgactcgctcgaatacacgatcatgacctaccacacatttatcggagacgatgagagt
ggggccaagtatgagcaaaatggcgcgccacaaaccttcatgatgctcgacatcgccgcc
ctgcaggaaatgtatggtgcggattacaccaccaacagtggcgataccgtctataggtgg
aatccgaaccagggcatcacctatgtcaatggggtggcagccatcacgcccgctgccaac
agggttttcgcaacaatctgggacggcggtggcaccgacacctatgatctgagcgcttat
accaccgccctcaagatcgacttgcatgcaggggggtattcggtctttcccagggtcagt
tggcctatctgggcggcggtccggatgatggctatgcccgcggcaacattttcaacgccc
ttctttatcacgacaatgtcgcgtcgttga

DBGET integrated database retrieval system