KEGG   Rhizobium etli CFN 42: RHE_CH00724Help
Entry
RHE_CH00724       CDS       T00317                                 

Gene name
rzcA
Definition
(GenBank) rhizobiocin/RTX toxin and hemolysin-type calcium binding protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
754521..759914
Genome map
AA seq 1797 aa AA seqDB search
MSGGAGDDVYIADNGNDAVIENANEGTDTVRTTVWSYTLGANVENLTYIGTGTFAGGGNA
ADNVITGGTGSDRLDGKAGADTLIGGAGDDQYTVDSLNDVVIEAAGGGVDTIWTDLNTYS
LAGIANIENLSFSGGGNSTGTGNSLDNIIKGGTGNDTLSGGVGNDTLIGGLGTDTLIGGT
GNDTYVVGDNGDTIIENVDEGIDTVQTTMWAYTLSANVENLIYSWIGAFAGTGNNLDNTI
TGGAASDTLSGGAGNDTLDGGAGADSLFGGAGNDTYIVDNAGDLVTEAADAGIDTVRTTL
SSYVLGSNVENLTYTGMAAVVGTGNNLANTIKGAAGADILDGKAGADILIGGVGDDTYIV
DDVADVVTERPNEGADLTKTTLSSYGLTNNVENLTFIGSGDFAGTGNRLANTITGGAGND
TLDGGAGNDTLNGGAGNDIYIVDSASDVINEAVGAGTDEIRTALAAYSIAALVNVENLTY
TGSANFTGTGNALANTITGGAGNDMLNGGAGADSLIGGLGDDTYIVDHAGDMVTEAADEG
TDTVRTTLASYTLGSDLENLTYSGTVAFTGTGNSLANTIKGGAGADTLDGKAGADMLIGA
AGNDTYIVDDAGDVVTEGLNEGTDWIKTALSSYTLGNNVENLLYTGSASFAGTGNALANT
IIGGVGNDTLDGGAGNDTLNGGAGNDIYIVDSASDVITEAVGAGTDEIRTALAAYSIAAL
VNVENLTYTGSANFTGTGNALANTITGGAGNDVLNGGIGADSLIGGAGGDAYVVDNAGDL
VSEAADAGIDTIWTTLAAYTLGANVENLTYFGTAAFAGTGNDLANMITGGTASDTLSGGV
GNDTLNGGAGADRLIGGVGNDIYIVDNAGDIVTEAADEGTDTVQTTLAAHTLAANVENLT
YTGTAAFVGIGNSLDNTITGGAAADTLAGGDGNDTLNGGAGADRLIGGTGDDTYIVDNAG
DLVTEAADAGTDTVRTALSSYTLGNNVENLTYTGTASFSGAGNALANTITGGAGNDVLNG
GAGADTLIGGAGHDTYIVDNAGDMVTEAADAGTDTVRTNLASYTLAGNVENLSFAGTGTF
AGTGNNLANTITGGAATDTLSGDAGNDTLDGGAGADSLIGGLGDDTYIVDHAGDMVTEAA
DEGTDTVRTTLASYTLGSDLENLTYSGTVAFTGTGNSLANTIKGGAGADTLDGKAGADML
IGAAGNDTYIVDDAGDVVTEGLNEGTDWIKTALSSYTLGNNVENLLYTGSASFAGTGNAL
ANTIIGGVGNDTLDGGAGNDTLNGGAGNDIYIVDSASDVITEAVGAGTDEIRTALAAYSI
AALVNVENLTYTGSANFTGTGNALANTITGGAGNDVLNGGIGADSLIGGAGGDAYVVDNA
GDLVSEAADAGIDTIWTTLAAYTLGANVENLTYFGTAAFAGTGNDLANMITGGTASDTLS
GGVGNDTLNGGAGADRLIGGVGNDIYIVDNAGDIVTEAADEGTDTVQTTLAAHTLAANVE
NLTYTGTAAFVGIGNSLDNTITGGAAADTLAGGDGNDTLNGGAGADRLIGGTGDDTYIVD
NAGDLVTEAADAGTDTVRTALSSYTLGNNVENLTYTGTASFSGAGNALANTITGGAGNDV
LNGGAGADTLIGGAGHDTYIVDNAGDMVTEAADAGTDTVRTNLAAYTLGTNVENLTFIGT
AAFAGTGNTLNNVIVGGSGSNMLTGGAGNDILIGGAAADVFVYSANWGHDTITNFVATGS
AHDAISIDHGIFADWEALFAATEQSGNDTIIIADSDNTITLRNVALSSLQSGDFLFA
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcggggcaggtgacgacgtctacatcgccgacaacggcaatgatgctgtcatt
gagaatgccaatgaggggacggacacggtccggacgacggtttggagttatacactcggc
gccaacgtcgaaaacctgacctatatcggcaccggtacgttcgccggtggtggcaatgcg
gcggacaatgtgatcaccggcgggacggggtctgatcggctggatgggaaggccggtgcc
gacacgctgatcggtggtgcgggcgacgatcaatatactgtcgatagtctcaacgatgtt
gtgatcgaggccgccggcggcggcgttgacacgatctggaccgatcttaacacttattcg
ctggcggggatcgccaatatcgagaacctatccttctcaggcggcggcaattctaccggc
accggcaacagcctcgacaatataatcaagggtgggacaggcaacgacacgctctctggt
ggggtaggcaacgatactctgatcggtggcttgggaactgacacgctcatcggtgggact
ggcaacgatacttatgtcgttggggataacggcgacactatcatcgaaaacgtcgacgag
gggatcgatacggttcagacgacaatgtgggcctacacattgtcagccaatgtcgagaac
ctcatctacagctggattggggcgtttgcgggcacgggcaacaatctcgacaacacgatc
acgggtggcgctgccagcgatacgctctccggcggcgccggcaatgacacgctggatggc
ggagcaggcgcggacagcttgttcggtggcgccggtaacgacacttacatcgtcgacaat
gccggcgacctcgtcaccgaagccgccgacgcagggatcgacacggttcggaccaccctg
tcaagctatgtgctcggtagcaatgtcgagaacctcacctataccggcatggcagccgtt
gtcgggaccggcaataacctcgccaacacgatcaagggcgcagcaggtgcggacatcttg
gacggaaaggccggagcagacatactgatcggcggtgtgggcgacgacacctatattgtc
gatgacgttgccgacgtcgtcactgaaaggccgaatgaaggagccgatctgaccaagacg
acgctttcttcctatggtttgaccaacaatgttgaaaatctaacctttatcggctccggc
gattttgctggtaccggaaacagacttgccaacacgatcaccggcggtgccggcaacgac
acgcttgacggcggcgccggcaacgacacgctgaacggtggcgccggtaacgacatctat
attgtcgacagtgcgagcgacgtgatcaacgaggcggtcggcgccggcaccgacgaaatc
cgcacggcgcttgcagcctactcgatcgccgcactggtcaatgtcgagaacctgacctac
acgggatccgccaacttcaccggcaccggcaatgcgcttgccaacacgatcaccggcggc
gccggcaacgatatgctgaatggcggggccggtgccgacagcctgatcggcggtttgggc
gacgacacttacatcgtcgaccatgccggcgacatggtcaccgaagcggccgacgaggga
accgacacggttcgcacgacgctggcaagctatacgcttggcagcgatctcgagaacctc
acctatagcggcacggtagcctttaccgggaccggcaacagcctcgccaacacgatcaag
ggcggggcaggtgccgacacgctggacggcaaggccggcgcagacatgctgatcggcgca
gccggcaacgacacctatattgtcgatgacgctggcgacgtggtcaccgaagggctgaat
gaaggaaccgattggatcaagacggcgctttcaagctatacgctcggcaacaatgtcgag
aacctgctctatacgggatccgccagcttcgccggcaccggcaatgcgctcgccaacacg
atcatcggcggtgtcggcaacgacacgcttgacggcggcgccggcaacgacacgctgaac
ggtggcgccggcaacgacatctatattgtcgacagtgcgagcgacgtgatcaccgaggcg
gtcggcgccggcaccgacgaaatccgcacggcgcttgcagcctactcgatcgccgcattg
gtcaatgtcgagaacctgacctacacgggatccgccaacttcaccggcaccggcaatgcg
cttgccaacacgatcaccggcggtgccggcaatgatgtgctgaatggtggaattggcgcc
gacagcttgatcggtggggcgggtggcgacgcctatgtcgtcgacaatgccggcgacctt
gtcagcgaagcggccgatgcagggatcgacacgatttggacgacattggccgcctacact
ctgggggccaatgtcgagaacctcacctacttcggcacggcagcctttgccggaacaggc
aatgatctcgccaacatgatcaccggtggcactgccagcgatacgctgtccggcggtgtc
ggcaacgacacgctgaatggtggggccggggccgatcgtttgatcggtggggttggcaac
gacatctatatcgtcgacaatgccggcgacatcgtcaccgaggccgccgatgaggggacc
gacacggtgcagacgacattggccgcccacacattggcggccaatgtcgagaacctcacc
tataccggcacggcagcctttgtcgggataggcaatagcctcgacaacacgatcaccggt
ggcgctgccgccgatacgcttgccggcggcgacggcaacgacacgctgaatggcggagcc
ggggccgatcgcttgatcggcgggacgggcgacgacacctatatcgtcgacaatgccggc
gacctcgtcaccgaggcggccgatgcggggaccgacacggttcgcacggcgctttcaagc
tatacgctcggcaacaatgtcgagaacctgacctatacgggaaccgccagcttcagcggc
gccggcaatgcgctcgccaacacgatcaccggcggcgccggcaacgatgtgctgaatggc
ggggcaggtgcggacaccttgatcggtggtgcgggccacgacacctatatcgtcgataat
gccggcgacatggtcacagaagccgccgacgcggggaccgacacggttcgcacgaacctg
gcgagctatacgcttgccggcaatgtcgagaatctgagctttgccggtacaggaactttc
gctggtaccggtaacaatctcgccaacacgatcacgggtggggctgccaccgatacgctt
tccggcgacgccggcaatgacacgcttgatggcggggccggtgccgacagcctgatcggc
ggtttgggcgacgacacttacatcgtcgaccatgccggcgacatggtcaccgaagcggcc
gacgagggaaccgacacggttcgcacgacgctggcaagctatacgcttggcagcgatctc
gagaacctcacctatagcggcacggtagcctttaccgggaccggcaacagcctcgccaac
acgatcaagggcggggcaggtgccgacacgctggacggcaaggccggcgcagacatgctg
atcggcgcagccggcaacgacacctatattgtcgatgacgctggcgacgtggtcaccgaa
gggctgaatgaaggaaccgattggatcaagacggcgctttcaagctatacgctcggcaac
aatgtcgagaacctgctctatacgggatccgccagcttcgccggcaccggcaatgcgctc
gccaacacgatcatcggcggtgtcggcaacgacacgcttgacggcggcgccggcaacgac
acgctgaacggtggcgccggcaacgacatctatattgtcgacagtgcgagcgacgtgatc
accgaggcggtcggcgccggcaccgacgaaatccgcacggcgcttgcagcctactcgatc
gccgcattggtcaatgtcgagaacctgacctacacgggatccgccaacttcaccggcacc
ggcaatgcgcttgccaacacgatcaccggcggtgccggcaatgatgtgctgaatggtgga
attggcgccgacagcttgatcggtggggcgggtggcgacgcctatgtcgtcgacaatgcc
ggcgaccttgtcagcgaagcggccgatgcagggatcgacacgatttggacgacattggcc
gcctacactctgggggccaatgtcgagaacctcacctacttcggcacggcagcctttgcc
ggaacaggcaatgatctcgccaacatgatcaccggtggcactgccagcgatacgctgtcc
ggcggtgtcggcaacgacacgctgaatggtggggccggggccgatcgtttgatcggtggg
gttggcaacgacatctatatcgtcgacaatgccggcgacatcgtcaccgaggccgccgat
gaggggaccgacacggtgcagacgacattggccgcccacacattggcggccaatgtcgag
aacctcacctataccggcacggcagcctttgtcgggataggcaatagcctcgacaacacg
atcaccggtggcgctgccgccgatacgcttgccggcggcgacggcaacgacacgctgaat
ggcggagccggggccgatcgcttgatcggcgggacgggcgacgacacctatatcgtcgac
aatgccggcgacctcgtcaccgaggcggccgatgcggggaccgacacggttcgcacggcg
ctttcaagctatacgctcggcaacaatgtcgagaacctgacctatacgggaaccgccagc
ttcagcggcgccggcaatgcgctcgccaacacgatcaccggcggcgccggcaacgatgtg
ctgaatggcggggcaggtgcggacaccttgatcggtggtgcgggccacgacacctatatc
gtcgataatgccggcgacatggtcacagaagccgccgacgcggggaccgacacggttcgc
acgaacctggccgcctacacattggggaccaatgtcgaaaacctcacctttatcggaacg
gcggcgtttgccggaacaggcaatacgctaaacaacgttatcgtcggtggcagtggttcc
aatatgctgacgggtggcgccggcaacgatatcctcattggtggagcggcagccgacgtc
ttcgtttattcggcgaactggggtcatgacacgatcacaaacttcgtggcaaccggctcc
gcacatgacgcgatctcgatcgatcacggcatcttcgccgattgggaagcgctttttgca
gcaaccgagcagtccggcaacgatacaattatcatagccgattccgacaacaccataacg
ttgaggaacgttgctctttcaagcctgcagtcgggggacttcttgtttgcttga

DBGET integrated database retrieval system