KEGG   Rhizobium etli CFN 42: RHE_CH00728Help
Entry
RHE_CH00728       CDS       T00317                                 

Definition
(GenBank) hypothetical conserved protein
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABC89543
RhizoBase: RHE_CH00728
UniProt: Q2KC93
Position
766742..766909
Genome map
AA seq 55 aa AA seqDB search
MSVPNEPIPDQPPMPAPGWKPVPPIKEPEPDRLPDEAPVPNPDENDEPARHVSGV
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcccaacgaacccattcccgatcagccgccgatgccggcgccaggctggaag
ccggtgccgccgatcaaggagcctgagccggacagattgcccgacgaggcgccggttccc
aatcccgatgagaacgacgagccggcaaggcatgttagcggcgtttaa

DBGET integrated database retrieval system