KEGG   Rhizobium etli CFN 42: RHE_CH00729Help
Entry
RHE_CH00729       CDS       T00317                                 

Definition
(GenBank) probable transcriptional regulator protein, LysR family
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30
Motif
Other DBs
NCBI-ProteinID: ABC89544
RhizoBase: RHE_CH00729
UniProt: Q2KC92
Position
complement(766906..767787)
Genome map
AA seq 293 aa AA seqDB search
MNWDDVRIFLAVARTGQILAASKRLGLNHATLSRRLTSLEEALKTRLFIRRTNGCELTAE
GEVFLHAAERMETEMLAVQANLGHTDTAIAGTVRVGAPDGFGVSFLAPRMGRLIERHPEL
KIQLVPVPRSFSLSQREADIAITLERPEQGRLVSSKLTDYTLGLYASRDYLAAHGRPGDV
EALKAHPRIGYVEDLLFTASLNFSGEVMRSWDAGFEISTAIGQTEAVRSGAGIGILHDYI
ARQYPELQRILPEISIRRAYWTTYHETARDLVRVRSVVDFLQELVSAERQIFL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggacgatgtccgcattttcctcgccgttgcccgcaccgggcagattcttgcc
gcttcgaagcggctggggctcaaccatgccacgctttcacggcggctgacatcgctcgaa
gaggcactgaagacgcggcttttcatccgccgcacgaatggctgcgagctgacggccgaa
ggcgaggtctttctgcacgccgccgagcgcatggaaaccgaaatgttggcagtgcaggcc
aatctcggccacaccgacacggcaatcgccggcacggtgcgtgtcggcgcgcccgacggg
ttcggcgtctcttttctcgcgccgcggatgggcaggttgatcgagcgtcatccggaattg
aagatccagctcgtgccggtcccgcgctccttctcgctgtcgcagcgcgaggccgacatc
gccatcacgctggaacgtcccgaacaaggccggctggtttcctccaagctgacggattac
acgctcggtctctatgcctcgcgcgattatctcgccgcccacggcaggcccggcgatgtc
gaggcgctgaaggcccatccgcgcatcggctatgtcgaggatctgctcttcaccgcctcg
ctgaatttctccggcgaggtgatgcgcagctgggacgccggcttcgaaatctcgacggcg
atcggccagacggaggcggtgcgatccggcgccggcatcggcattctgcatgattatatc
gcccggcagtatccggagctccagcgcatcctgcctgagatctcgatccgccgcgcctat
tggacgacctatcacgaaacggcgcgcgacctcgtgcgcgtcaggagcgtcgtcgacttc
ctgcaggaactcgtcagcgccgagcggcagatctttctttaa

DBGET integrated database retrieval system