KEGG   Rhizobium etli CFN 42: RHE_CH00736Help
Entry
RHE_CH00736       CDS       T00317                                 

Gene name
dppAch1
Definition
(GenBank) dipeptide ABC transporter, substrate-binding protein
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ret02010  ABC transporters
ret02030  Bacterial chemotaxis
Module
ret_M00324  Dipeptide transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH00736 (dppAch1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_CH00736 (dppAch1)
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00324] [OT]
    RHE_CH00736 (dppAch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ABC89550
RhizoBase: RHE_CH00736
UniProt: Q2KC86
Position
773279..774874
Genome map
AA seq 531 aa AA seqDB search
MKKISVMLAATALISVMATSAWSKTLVYCSEGSPEGFDPSLYTSGTTFDASSRTVYSRLV
EFKHGGTEIEPGLADSWSVSADGTEYTFKLHPGVKFQTTDFFTPTRDFNADDVVFSFERQ
LKADNPWNKYVEGGSYEYAAGMGFPELIKSVEKVDDLTVKFTLNHPEAPFLADLAMDFAS
IVSKEYADKLAADGKMAQLNQQPLGTGPFTFVAYQPDAVIRYKANESYFKGKEKIDDLVF
AITSDAAVRAQKLKAGECHLIPYPNAADVPELKKDGNLTVQEQAGLNVGFLAYNTQMAPF
DKPEVRRALNMAINKQAVIDAVFQGAAAVAKNPIPPTMWSYNDAVQDDKYDPEAAKKALA
DAGVKDLSMKVWAMPVSRPYMLNARRAAELIQADFAKIGVKVEIVTHEWAEYLKLSSDVK
RDGAVILGWTGDNGDPDNFMDTLLGCDAVGGNNRAQWCNKEYDDLMTKAKLTADVGERTK
AYEQAQLIFKKEAPWATLDHSLVFVPMSKKVSGFKMDPLGIHRFDGVDVSE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatctctgtcatgctggcagcgacggccctgatttcggtcatggcgacgtcg
gcctggtccaagacccttgtttattgctccgagggttcgccggaaggcttcgacccgagc
ctctatacgtcgggcacgaccttcgacgcctcgtcgcgcacggtctacagccgcctcgtc
gaattcaagcatggcggcaccgagatcgaacccgggctcgccgacagctggagcgtttcg
gccgacggcacggaatacaccttcaagcttcatcccggcgtcaagttccagaccaccgac
ttcttcacgccgacgcgcgatttcaacgccgacgacgtcgtgttctccttcgagcgccag
ctgaaggccgacaatccctggaacaagtatgtcgagggcggttcctacgaatacgctgcc
ggcatgggctttccggagctgatcaagtcggtcgaaaaggtcgatgacctcaccgtcaag
ttcacgctcaaccatcctgaagcgccgttcctggccgacctcgccatggatttcgcttcg
atcgtctccaaggaatatgccgacaagcttgccgccgacggcaagatggcgcagctcaac
cagcagccgctcggcaccggccccttcaccttcgtcgcttatcagccggatgccgtcatc
cgctacaaggcgaacgaaagctatttcaagggcaaggaaaagatcgacgatctggttttc
gctatcacctccgacgccgccgtccgcgctcagaagctgaaggccggcgaatgccacctg
atcccctatccgaatgccgccgacgttccggaactgaagaaggatggaaatctgaccgtt
caggaacaggccggcctcaatgtcggtttcctcgcctacaacacccagatggccccgttc
gacaagccggaagtccgccgtgcgctgaacatggcaatcaacaagcaggctgtcatcgac
gccgtcttccagggtgcggccgccgttgccaagaacccgatcccgccgaccatgtggtcc
tataacgacgccgttcaggacgacaagtatgatcctgaggccgccaagaaggcgcttgcc
gatgccggcgtcaaggatctcagcatgaaggtctgggcgatgccggtgtcgcgtccctac
atgctgaacgcgcgccgcgccgccgaactgatccaggccgatttcgccaagatcggcgtc
aaggtcgagatcgtcacccatgaatgggccgaatatctgaagctctcctccgacgtgaag
cgcgacggcgccgtcatcctcggctggaccggcgacaacggcgaccctgacaacttcatg
gatacgctgctcggctgcgatgccgtcggcggcaacaaccgcgcccagtggtgcaacaag
gaatatgacgacctgatgaccaaggccaagctgacggccgacgtcggcgagcgcaccaag
gcctatgagcaggcgcagctcatcttcaagaaggaagccccctgggcgaccctcgaccac
tcgctcgtcttcgttccgatgagcaagaaggtctcgggcttcaagatggacccgctcggc
attcaccgtttcgacggcgtcgacgtatccgaataa

DBGET integrated database retrieval system