KEGG   Rhizobium etli CFN 42: RHE_CH00979Help
Entry
RHE_CH00979       CDS       T00317                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHE_CH00979 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00979 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHE_CH00979 (thrC)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHE_CH00979 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1028221..1029645)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPAATFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSTAANVHALAVEGNFDDCQNLVKAMFNDAAFRDKVSLSGVNSINWARIMAQIVYYFTT
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILTRTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSGGFEIAPEALKVIRRD
FRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKQEKPNTPMVTLSTAHPAKFPA
AVKSACGIDPALPTWLAGLMHREERFQIIKPELKAVETFIGQHARSETTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtggactatatctcgacccgcggcgaggcccctgccctcggcttttgcgac
gcccttttgacgggactggcgcgcgatggcgggctctatgttccccgcgagtggccgcag
ttttcgaagaaggaaatccgcgcgctgaggggcaagacctatcaggaaatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgcggcgaccttccgggcgatgatcgac
gaggcctacggcaccttccgtcatccggcgatcgcgccgctcgtccagaccgggccaaac
agcttcgtcatggagctcttccacggcacgacgctcgccttcaaggacgtggcgatgcag
ctgctggcacggctgatggactatgcgctggaaaaacgtggggagcgggcgacgatcgtc
ggcgccacctcgggcgataccggcggcgcggcgatcgacgcctttgccgggcgcgagcgc
accgatatcttcattcttttcccgcacggcaaagtttcgccggtgcagcagcggcagatg
acgacctcgacggccgccaatgtgcatgcgctggctgtcgaaggcaatttcgacgactgc
cagaacctcgtcaaagcgatgttcaacgacgcggcgttccgcgacaaggtcagcctgtcg
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctactatttcaccacg
gcggtggcgctcggcgggccggaccggaagatctcctttaccgtgccgaccggcaatttc
ggcgatatcttcgccggctactgcgccaagcgcatgggcctgccgatcgaccgtctggtc
atcgccaccaacgagaacgacattctcacacgcacactgaagaccggccgctacgacatg
aaggccgtcaaggcgacgagctcgccgtcgatggacatccagatctcatcgaatttcgaa
cggctgctgttcgaagcctatgggcgcgacgcctcgaaggtgcgcgcggcgatggaaagc
ctgaagcaatcgggcggcttcgagatcgctcccgaggcgctgaaggtcatccgccgtgac
ttccgcgccggccgcgccagcgagaagcaggtggccgagacgatccgcaagacccatgcc
gaaaccggctatctcctcgatccgcattcggcgatcggcgtcttcgtcgccgccaagcag
gagaagccgaatacgccgatggtgacgctttcgaccgcccatccggcgaaattcccggcc
gccgtaaaatcggcctgcggtattgacccggcgcttccgacgtggcttgctggtctgatg
cacagggaggagcgcttccagatcatcaaaccggagctgaaagccgttgaaacctttatc
ggccagcacgcccgcagcgagacgacagcaggcgcagaaagatag

DBGET integrated database retrieval system