KEGG   Rhizobium etli CFN 42: RHE_CH00979Help
Entry
RHE_CH00979       CDS       T00317                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHE_CH00979 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_CH00979 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHE_CH00979 (thrC)
Enzymes [BR:ret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHE_CH00979 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1028221..1029645)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPAATFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSTAANVHALAVEGNFDDCQNLVKAMFNDAAFRDKVSLSGVNSINWARIMAQIVYYFTT
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILTRTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSGGFEIAPEALKVIRRD
FRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKQEKPNTPMVTLSTAHPAKFPA
AVKSACGIDPALPTWLAGLMHREERFQIIKPELKAVETFIGQHARSETTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtggactatatctcgacccgcggcgaggcccctgccctcggcttttgcgac
gcccttttgacgggactggcgcgcgatggcgggctctatgttccccgcgagtggccgcag
ttttcgaagaaggaaatccgcgcgctgaggggcaagacctatcaggaaatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgcggcgaccttccgggcgatgatcgac
gaggcctacggcaccttccgtcatccggcgatcgcgccgctcgtccagaccgggccaaac
agcttcgtcatggagctcttccacggcacgacgctcgccttcaaggacgtggcgatgcag
ctgctggcacggctgatggactatgcgctggaaaaacgtggggagcgggcgacgatcgtc
ggcgccacctcgggcgataccggcggcgcggcgatcgacgcctttgccgggcgcgagcgc
accgatatcttcattcttttcccgcacggcaaagtttcgccggtgcagcagcggcagatg
acgacctcgacggccgccaatgtgcatgcgctggctgtcgaaggcaatttcgacgactgc
cagaacctcgtcaaagcgatgttcaacgacgcggcgttccgcgacaaggtcagcctgtcg
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctactatttcaccacg
gcggtggcgctcggcgggccggaccggaagatctcctttaccgtgccgaccggcaatttc
ggcgatatcttcgccggctactgcgccaagcgcatgggcctgccgatcgaccgtctggtc
atcgccaccaacgagaacgacattctcacacgcacactgaagaccggccgctacgacatg
aaggccgtcaaggcgacgagctcgccgtcgatggacatccagatctcatcgaatttcgaa
cggctgctgttcgaagcctatgggcgcgacgcctcgaaggtgcgcgcggcgatggaaagc
ctgaagcaatcgggcggcttcgagatcgctcccgaggcgctgaaggtcatccgccgtgac
ttccgcgccggccgcgccagcgagaagcaggtggccgagacgatccgcaagacccatgcc
gaaaccggctatctcctcgatccgcattcggcgatcggcgtcttcgtcgccgccaagcag
gagaagccgaatacgccgatggtgacgctttcgaccgcccatccggcgaaattcccggcc
gccgtaaaatcggcctgcggtattgacccggcgcttccgacgtggcttgctggtctgatg
cacagggaggagcgcttccagatcatcaaaccggagctgaaagccgttgaaacctttatc
ggccagcacgcccgcagcgagacgacagcaggcgcagaaagatag

DBGET integrated database retrieval system