KEGG   Rhizobium etli CFN 42: RHE_CH01212Help
Entry
RHE_CH01212       CDS       T00317                                 

Definition
(GenBank) probable sugar ABC transporter, ATP-binding protein
  KO
K17215  
inositol transport system ATP-binding protein
Organism
ret  Rhizobium etli CFN 42
Pathway
ABC transporters
Module
Inositol transport system
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RHE_CH01212
Transporters [BR:ret02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Inositol transporter [MD:M00593] [OT]
    RHE_CH01212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(1263611..1265185)
Genome map
AA seq 524 aa AA seqDB search
MSATLQRVAPLSGGEGHRTPIDSGAGFVLEMRSITKAFPGVLALDGMSLKVRAGTVHVLV
GENGAGKSTLMKILSGIYAIDGGEILFRGEKLDHQSAAAALERGISMIHQELSPVLDMTI
AENIFLGREPTYSRTGVLSRFVDFDRMNSDTQTLLDRLGLKYSPQTKMRDLSIATMQLIE
IVKAISREASLIIMDEPTSAISDTEVAMLFRQIADLKAAGVAIIYITHKMDEIFQIADDI
TVMRDGQFVAAAPASEYEPAKLISQMVGRTISSIFPKEEVPIGDIVLSVENLSRDGVFDN
VGFEVRAGEIVGLSGLIGAGRTEVARVIFGLDAADAGVVRLNGKPLKLTSPKDAIANGIA
MVSEDRKAEGLVLCRSVGENISLANLKKFASGIFISERQEETASQRMIKMLQIKTPDTAM
IVENLSGGNQQKIVLAKWLLGDLKLLILDEPTRGIDVGSKSEIHRLMTEFARQGLAIIMI
SSELPEILGMSDRVVVMSEGRVTGELTRAEATQENIMRLATGGH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaccttgcaaagggtggcgccgctttcgggcggcgaaggccatcgcacgcct
atagatagcggagccggcttcgttcttgaaatgcgctcaatcaccaaggccttccccggt
gttctcgcgctcgatggcatgagcctgaaggttcgtgcaggcaccgtccatgttctcgtc
ggggagaatggcgcgggcaagtcgacgctcatgaagattctaagcggcatctacgcgatc
gacggcggagagatccttttcagaggcgaaaagctcgaccatcagagcgccgcagccgcg
ctggagcgagggatctcgatgatccatcaggaactcagcccggtgctagacatgactatc
gccgaaaacatctttctcggccgcgaacccacttatagcaggacgggcgttttgtcccgg
ttcgtcgatttcgatcgcatgaactcagatacgcagacgctgctcgatcgtttgggtctg
aaatacagcccccaaaccaagatgcgagatctgtccatcgccacgatgcagctcatcgaa
attgtcaaggcgatttctcgtgaggcctccctcatcatcatggacgaaccgacgtcggcg
atcagcgacaccgaagttgcgatgctcttcaggcagatcgcagacctgaaagcagcaggc
gtcgcgatcatctacatcacccacaagatggacgagatcttccagattgccgacgacatc
acggtgatgcgtgatggccagttcgtcgctgccgccccggcgagcgaatacgagccggca
aagctgatttcccagatggtgggacgcacgatctccagcatctttccgaaagaagaagtg
ccgatcggcgacatcgttctttccgtcgagaacctctctcgtgacggcgttttcgacaat
gtcggcttcgaggtgcgtgccggcgaaatcgttggcctttccggcctgatcggcgccggg
cggacggaggtagcccgggtgatcttcggcttggacgcggcggacgcgggcgtcgtccgc
ctgaatggaaagccgctaaagctcacgtcgcctaaggatgccattgccaacggcatcgcc
atggtctcggaagatcgaaaggcggaaggtctggtgctttgccggtccgtcggcgagaac
atctcgctcgcgaaccttaagaagttcgcctccggcattttcatcagcgagcggcaggaa
gagacagcttcccagcgcatgatcaagatgctccagatcaagacgcccgatacggcaatg
atcgtggagaacctcagcggcggcaatcaacagaaaatcgttctcgccaagtggctgctg
ggtgatctgaagctgctcattctcgatgaacccacacgaggcatcgacgtcgggtcgaaa
tccgaaattcacagactgatgaccgagttcgctcgtcaggggctcgcgatcatcatgatc
tcatccgaactgcccgagatcctcggcatgagtgaccgcgtggtggtgatgagcgaaggc
cgggtcaccggcgaactaacaagagccgaggccacgcaggaaaacatcatgcgcctcgcc
acgggaggacactga

DBGET integrated database retrieval system