KEGG   Rhizobium etli CFN 42: RHE_CH01544Help
Entry
RHE_CH01544       CDS       T00317                                 

Gene name
celC
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_CH01544 (celC)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RHE_CH01544 (celC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1622785..1623831
Genome map
AA seq 348 aa AA seqDB search
MRWWCVLLLAATAAFAPASPSAAAQQAMINADAWSAYKAKFLDASGRIVDNGNGNISHSE
GQGYGMLLAYLSASPADFEQIWYFTRTELLLRDDGLAVWKWDPNIKPHVTDTNNASDGDM
LIAYALALAGTAWKRNDYILAASRMAQALLAEAVVRSAGRTLLMPGSEGFGAADRDDGPV
VNPSYWIYEAMPVMAALAPSDAWKELSDDGVALLKTMQFGPRKLPAEWVSLSGAPRPAEG
FDAEFAYNALRIPLYLARGGITDKALLNRLRTGMSQNGVPATIDLTTGRPKTVLLDPGYK
IVNDVVACVVDGTRLPVSALQFAPTLYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtggtgcgtgcttctgcttgcggcgacggctgcgttcgcccccgcaagcccg
tccgccgccgcacagcaggcgatgatcaatgccgatgcgtggtccgcctacaaggcgaag
tttctcgatgcgagcggccggatcgtcgataatggcaacggcaatatcagtcatagcgaa
gggcagggctatggcatgctgctcgcctatctctcggcaagccccgcggatttcgagcag
atctggtattttacccgcaccgagttgctgttgcgcgacgatggcctggccgtctggaaa
tgggatcccaacatcaagccgcacgtgaccgacaccaataatgcctcggatggcgacatg
ctgatcgcctatgccctggcgcttgccggtactgcatggaagcgcaacgactatatcctc
gccgcctctcgcatggcgcaggcgctgcttgccgaagctgtcgtccgctcggcgggccgg
acgctgctgatgccgggcagcgaaggttttggcgccgccgatcgtgacgacggtcctgtc
gtcaatccttcctactggatttacgaggcaatgcctgtcatggcagcacttgctccctcc
gatgcgtggaaagagctgtcggacgatggcgtggcgctgttgaagaccatgcagttcggt
ccgcgcaagcttcctgccgaatgggtcagcctcagtggcgcaccgcgaccggcagagggt
ttcgacgccgagtttgcctataacgccctacgcatcccgctctatctcgcgcgcggcggc
atcacggacaaggcgctgttgaaccgcctgcgaacggggatgtcgcagaatggcgtcccg
gccacgatcgatctgaccacagggcggccgaagaccgtgttgctggacccgggttataaa
attgttaatgatgttgtggcctgtgtagtcgacgggaccaggctgccggtctcggctctg
caattcgcgcccacactctattatccgtccacgcttcaactgctggggctggcctatatc
ggggagaagcatccggagtgtctgtga

DBGET integrated database retrieval system