KEGG   Rhizobium etli CFN 42: RHE_CH01585Help
Entry
RHE_CH01585       CDS       T00317                                 

Definition
cytochrome P450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_CH01585
  Amino acid metabolism
   00380 Tryptophan metabolism
    RHE_CH01585
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RHE_CH01585
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RHE_CH01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1666011..1667255)
Genome map
AA seq 414 aa AA seqDB search
MMIPPFLSIDRASRHVSLDARNPDFYGNPNAVYAALHAHCPTFYWTEQKQWFFTGYDHVN
ALLRDRRFGRQILHIARREELGLAEPMPHLESFDLSERYSLLELEPPEHTRLRTLVNRAF
VSRHVEKMKPELAELANRLIDGFADKREVELLSAFADIIPVTMIARMIGIPEEMGPQLLA
WSHAYVRMYMFGRTREQEDEAERAAKEFSDYVRTVIAERRNAPRDDLLTHMIHTEHKGQY
LTEEELISTTIVLLNAGHEATVHQIGNSVRTILDSGSDPAVLFRDEATTERTVEETLRIC
APVHIFQRWALEPAEIDGVSFKRGDKVSLILAAANVDPAKFTDPLTFRPDRNEAPNLSFG
AGIHFCIGAPLARLELNVVLPILFERLAGLSLAKTPVVKDVYHFHGLDRLDLLW
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgatgataccgccctttctctcgatcgaccgcgccagccgccatgtctcgctggacgcc
cgcaatcctgatttctacggcaatccgaacgccgtctatgccgcacttcacgcccattgc
ccgaccttctattggacggagcagaagcagtggttcttcaccggctacgaccacgtgaac
gcactgctgcgcgaccgccgcttcggccggcagatcctgcatatcgccagacgcgaggaa
ctcggcctggccgagccgatgccgcatcttgaaagtttcgacctctcggaacgctattcc
ctgctcgaactcgaaccgccggagcacacgcggctgcgcacgctcgtcaaccgcgccttc
gtctcgcgtcatgtcgagaaaatgaagccggagcttgccgaactcgccaatcgcttgatc
gacggtttcgccgataagcgcgaggtcgagctgctctcggcctttgccgacatcatcccg
gtgacgatgatcgcccgcatgatcggcattccggaggagatggggccgcagctgctcgcc
tggtcgcatgcctatgtccgcatgtacatgttcggccgcacgcgcgagcaggaagacgag
gccgagcgggccgcgaaggaattttccgactatgtcaggactgtgatcgcggagcgccgc
aacgcgccgcgcgacgacctgctcacccacatgatccataccgagcacaagggccagtat
ctgaccgaggaggagctgatctcgacgacgatcgtgctgcttaatgccgggcacgaggca
accgtacaccagatcggcaattccgtgcgcactatcctcgacagcggctcggatccggcc
gtgctcttccgggacgaggccacgacggagcgcaccgtcgaggaaactctgcgcatctgc
gcgccggttcatatcttccagcgctgggcgctggagcctgccgaaatcgacggggtctcc
ttcaaacgcggcgacaaggtcagcctcatcctcgccgccgccaatgtcgatccggcgaaa
ttcactgatcccctcaccttccggcccgatcgcaacgaggctccaaacctctccttcggc
gccggcatccatttctgcatcggggccccactggcgcggctggagcttaacgtcgtcctt
ccgatcctgttcgaacggcttgccggcctcagtctggcgaagacgcccgtcgtcaaggac
gtctatcatttccacgggctcgaccgcctagatctcctgtggtga

DBGET integrated database retrieval system