KEGG   Rhizobium etli CFN 42: RHE_CH01597Help
Entry
RHE_CH01597       CDS       T00317                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ret00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ret00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1681033..1681581
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRPTTLNEYKGRVLLIVNVASKCGLTPQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVTTTG
DGPMRERLKAHGISGGDEDDILWNFEKFLIGRDGEIVARFAPDVTADDPRLVSAVDRELA
KG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgtgctggatattccggtcaagacggtggatggtcgaccaaccacgctg
aacgaatacaagggcagggtgcttctgatcgtcaacgtcgcctcgaaatgcgggctcacg
ccgcaatatgaggggcttgaaaagctctatggggaaaagcgcgagcgcggcttcgtcatc
gccgctttccccgccaacgacttcaagggccaggaacccggcaccgatgccgagatcctc
gatttctgcacttccacctacgacgttaccttcccgatcttctcgaagatttcggtcaag
ggcgaggcccagcacccgctctaccggcaactgaccaaatcgggcgtgacgaccaccggc
gacggcccgatgcgcgaacgcctgaaagcccacggcatatcaggcggcgacgaggacgac
atcctctggaacttcgaaaagttcctgatcggccgcgacggcgaaatcgtcgcccgattc
gcacctgatgtgacggcggatgatccgcggctggtttcagcggtggacagagaactggcg
aagggatga

DBGET integrated database retrieval system