KEGG   Rhizobium etli CFN 42: RHE_CH01809Help
Entry
RHE_CH01809       CDS       T00317                                 

Gene name
pcm1
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ret  Rhizobium etli CFN 42
Brite
Enzymes [BR:ret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RHE_CH01809 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_32 Methyltransf_24 Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABC90602
RhizoBase: RHE_CH01809
UniProt: Q2K984
Position
1892794..1893459
Genome map
AA seq 221 aa AA seqDB search
MMDFEAARAKMVDTQIRTTDVTSHSVLTAFLTVPREAFVPEKSKLLAYIDNDVEISAAAP
GKPARFLMEASPLAKLLQLAAIGKDDFVLEVGCGTGYTSALLSIIAGSVIALECDEALAA
EAKAKLAGYGKIEVVTGPLEKGYAAGAPYDLIFINGAVEEVPAALLGQLRDGGRLVTVEG
HGNAARAKVFVAERGAISENVFFNASVKPLPGFAKAREFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttcgaagcagcgcgcgcaaagatggtcgacacccaaatccgcaccacggat
gttacctcgcattccgtgctgacggcttttctcacagtgccccgcgaggctttcgtgccg
gagaagtcaaagctgctggcctatatcgacaacgatgtcgaaatatcggccgctgcaccg
ggcaagccggcccgcttcctaatggaggcctcgccgctcgccaagctgctgcagttggcc
gccatcggcaaagacgatttcgtgctcgaggtcgggtgcggcaccggatatacatcggcg
ctgctgtcgatcatcgccgggtcggtcattgccctcgaatgcgacgaggcactggctgcc
gaagcgaaggcaaagcttgccggctatggcaagatcgaggtcgtgacgggtcccctcgaa
aagggctacgccgccggcgccccctatgatctgatcttcatcaacggcgcggtcgaggag
gttccggccgctcttctcggtcagttgcgcgatggcggccgtctggtcacggtcgaaggg
cacggcaatgcggctcgtgccaaggtcttcgtcgccgagcgcggcgcaatctcggagaat
gtcttcttcaacgcttcagtcaagccgctgccgggtttcgcgaaggcgcgcgaattcgtt
ttctga

DBGET integrated database retrieval system