KEGG   Rhizobium etli CFN 42: RHE_CH01820Help
Entry
RHE_CH01820       CDS       T00317                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ret  Rhizobium etli CFN 42
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHE_CH01820
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RHE_CH01820
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHE_CH01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1908718..1909788
Genome map
AA seq 356 aa AA seqDB search
MCIAPALARIWPAAVYDSSMTESKAMILGCSGLALTSEEKAFYRDERPWGFILFGRNISE
TAQITDLVAELRDSVGWHAPVLIDQEGGRVQRIRPPVLPRYPSGQALGDLYRRDPALGLR
AAWVMSRLHAFDLSNLGINVDCLPVLDVPVEGSSNVIGDRAYGGDPETVIAMGRAAGEGL
KAGGLLPVMKHMPGHGRGFADSHLELPVVTVSRDELETHDFPPFIAMKDELMAMTCHLVF
TSIDPDNPATTSRKVIDDVIRQHIGFGGLLLSDDSSMNALSGTIGERAANIIAGGCDIVL
HCNGHMDEMRAVVANVPPLAGLSLSRAKAVEAGFAAPDTADEAELRAEFEAMFVSV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcatcgcgcccgcgctcgctcgcatttggcccgccgccgtttatgattcttccatg
accgaatcaaaagcgatgatccttggctgcagcggccttgccctcacatccgaagaaaag
gccttttaccgggacgaacggccctggggtttcatcctcttcgggcgcaatatctccgaa
acagcgcagatcaccgatctcgtcgccgaattgcgcgacagcgtcggctggcatgcgccg
gtgctgatcgatcaggagggtggtcgcgtccagcgcatccgtccgccggttctgccgcgt
tatccctcaggccaggcgctgggcgatctctatcgccgcgacccggcgctcgggctgcgc
gccgcctgggtgatgtcgcgcctgcatgccttcgacctgtcgaaccttggcatcaatgtc
gattgcctgccggttctcgacgtgccggtcgaaggcagcagcaacgtcatcggcgaccgc
gcctatggcggcgatcccgagaccgtcatcgcaatgggacgggcggccggcgaggggctg
aaggccggcggcctgctgcccgtgatgaaacatatgcccggccacggtcgcggctttgcc
gattcacatctggagctgcctgtcgttaccgtctcgcgcgatgagctggagacccatgat
ttcccccccttcatcgcgatgaaggacgagttgatggcaatgacctgccatctcgtcttc
acatcaatcgaccctgacaatccggcgacgacctcgcgcaaggtgatcgacgacgtcatc
cgtcagcacatcggttttggcggtctgctgctttccgacgacagctcgatgaatgcgctt
tccggcacgatcggtgaacgggcggcgaatatcattgcagggggatgcgatatcgtgctg
cattgcaatggccatatggacgagatgcgggcggtcgtggcaaatgttccgccgctcgcc
ggtctttcgcttagccgcgcaaaagcggtagaagcaggctttgccgcgccggatactgcc
gatgaggcggagttgagggcggaattcgaggcgatgttcgtgtcggtgtga

DBGET integrated database retrieval system