KEGG   Rhizobium etli CFN 42: RHE_CH01935Help
Entry
RHE_CH01935       CDS       T00317                                 

Gene name
pdhB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_CH01935 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH01935 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RHE_CH01935 (pdhB)
   00620 Pyruvate metabolism
    RHE_CH01935 (pdhB)
Enzymes [BR:ret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHE_CH01935 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2019132..2020484
Genome map
AA seq 450 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAASAPKADAAPAKAEAAPAA
APAPTAAPAAVSAGGNRTFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDIEAALAGGA
KPAPAPAAASAPQAVAPAPAAAPKGASDDAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVSVDCELDALMALRAQLNDAAPRKENAPAYKLSVNDMVIKAMALALRDVPDAN
VSWTDSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSAISNEMRDLGKRAKDRKLKP
EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLS
TDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagctgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgccgttctcgcggccgat
ggcgaggatgtcgccgctgccgcaagcggcgcgggttccgctgctccggccaaggctgag
gctgcatctgcgccgaaagccgacgctgcgccagcgaaggctgaggccgctccggccgcg
gcaccggcacctaccgctgcacccgcggccgtttcggctggtggcaaccgcaccttttct
tcgccgctcgcacgccgcctggccaaggaagccggcatcgacctttcggccgtcgccggt
tctggtccgcatggccgcgtgatcaagagcgatatcgaagctgcccttgccggcggcgcc
aagcccgctccggcgcctgccgctgcttcggctccgcaggctgtcgcgccggctcctgcc
gccgcgccgaagggcgcttccgatgatgccgttctcaagctgttcgagccgggctcctac
gagctcgtcccgcatgacggcatgcgcaagacgattgcccggcgcctggtcgagtcgaag
cagacgatcccgcatttctatgtcagcgtcgattgcgagctcgatgcgctgatggcgctg
cgcgcccagctcaacgatgcggcgccgcgcaaggaaaacgcgccggcctacaagctctcg
gtcaacgacatggtgatcaaggccatggcgctggcattgcgcgacgttccggacgccaat
gtgtcgtggaccgacagcaacatggtcaagcacaagcacgccgacgtcggcgtcgccgtc
tcgatccccggcggcctgatcaccccgatcattcgcaaggccgaacagaagacgctgtct
gccatctccaacgagatgcgcgatctcggcaagcgcgccaaggaccgcaagctgaagccc
gaggaatatcagggcggcaccagctcggtctcgaacatgggcatgatgggcgtcaagaat
ttcgccgccgtcgtcaacccgccgcatgcgacgatcctcgcagtcggcgccggggagcag
cgggtcgtcgtcaagaacggcgaaatggcgattgccaccgtgatgtcggtgacgctgtca
accgaccatcgttgcgtcgacggtgcgctcggcgccgagctcctccaggccttcaagggc
tacatcgaaaacccgatgggcatgctcgtctaa

DBGET integrated database retrieval system