KEGG   Rhizobium etli CFN 42: RHE_CH01935Help
Entry
RHE_CH01935       CDS       T00317                                 

Gene name
pdhB
Definition
(GenBank) dihydrolipoamide acetyltransferase protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00020  Citrate cycle (TCA cycle)
ret00620  Pyruvate metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01200  Carbon metabolism
Module
ret_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH01935 (pdhB)
   00020 Citrate cycle (TCA cycle)
    RHE_CH01935 (pdhB)
   00620 Pyruvate metabolism
    RHE_CH01935 (pdhB)
Enzymes [BR:ret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHE_CH01935 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABC90721
RhizoBase: RHE_CH01935
UniProt: Q2K8W5
Position
2019132..2020484
Genome map
AA seq 450 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAASGAGSAAPAKAEAASAPKADAAPAKAEAAPAA
APAPTAAPAAVSAGGNRTFSSPLARRLAKEAGIDLSAVAGSGPHGRVIKSDIEAALAGGA
KPAPAPAAASAPQAVAPAPAAAPKGASDDAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVSVDCELDALMALRAQLNDAAPRKENAPAYKLSVNDMVIKAMALALRDVPDAN
VSWTDSNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSAISNEMRDLGKRAKDRKLKP
EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLS
TDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagctgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgccgttctcgcggccgat
ggcgaggatgtcgccgctgccgcaagcggcgcgggttccgctgctccggccaaggctgag
gctgcatctgcgccgaaagccgacgctgcgccagcgaaggctgaggccgctccggccgcg
gcaccggcacctaccgctgcacccgcggccgtttcggctggtggcaaccgcaccttttct
tcgccgctcgcacgccgcctggccaaggaagccggcatcgacctttcggccgtcgccggt
tctggtccgcatggccgcgtgatcaagagcgatatcgaagctgcccttgccggcggcgcc
aagcccgctccggcgcctgccgctgcttcggctccgcaggctgtcgcgccggctcctgcc
gccgcgccgaagggcgcttccgatgatgccgttctcaagctgttcgagccgggctcctac
gagctcgtcccgcatgacggcatgcgcaagacgattgcccggcgcctggtcgagtcgaag
cagacgatcccgcatttctatgtcagcgtcgattgcgagctcgatgcgctgatggcgctg
cgcgcccagctcaacgatgcggcgccgcgcaaggaaaacgcgccggcctacaagctctcg
gtcaacgacatggtgatcaaggccatggcgctggcattgcgcgacgttccggacgccaat
gtgtcgtggaccgacagcaacatggtcaagcacaagcacgccgacgtcggcgtcgccgtc
tcgatccccggcggcctgatcaccccgatcattcgcaaggccgaacagaagacgctgtct
gccatctccaacgagatgcgcgatctcggcaagcgcgccaaggaccgcaagctgaagccc
gaggaatatcagggcggcaccagctcggtctcgaacatgggcatgatgggcgtcaagaat
ttcgccgccgtcgtcaacccgccgcatgcgacgatcctcgcagtcggcgccggggagcag
cgggtcgtcgtcaagaacggcgaaatggcgattgccaccgtgatgtcggtgacgctgtca
accgaccatcgttgcgtcgacggtgcgctcggcgccgagctcctccaggccttcaagggc
tacatcgaaaacccgatgggcatgctcgtctaa

DBGET integrated database retrieval system