KEGG   Rhizobium etli CFN 42: RHE_CH02143Help
Entry
RHE_CH02143       CDS       T00317                                 

Gene name
speB2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ret  Rhizobium etli CFN 42
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHE_CH02143 (speB2)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RHE_CH02143 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2244890..2245873
Genome map
AA seq 327 aa AA seqDB search
MFDPEFRKVADLVFGEGDRRQAPYCGVPTLLKAPYRPDAAPSFADIDIALFGIPMDLGVT
NRSGARFGPRAVRNVDRVGPYDHVLRTAPTAHARVADVGDVPFKSRFDLAASHDDIEKFV
GGLIGAGVVPLAVGGDHSVGLPILRAVGRDRPVGMIHIDAHCDTGGSFEGCKFHHGGPFR
QAVLDGVLDPRRTIQIGIRGNSEYLWEFSYASGMTVIHAEDVGDLGISAVIAKAREIVGA
GPTYVSFDVDSLDPAFAPGTGTPEVGGLTSAQALGILRGLIGLNIVGGDVVEIAPQYDPT
SNTAQIAAQVLFELLCLAAEAIKVRAP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatccggagtttcgcaaggtggccgacctggtcttcggcgaaggcgatcgtcgc
caggcgccttactgcggcgtcccgacattgctgaaggccccgtatcgtccggacgccgcg
cccagttttgccgatatagatattgcgcttttcggcattccgatggatctcggggtgacg
aaccggtcgggcgcgcggttcgggccaagagccgtacgcaacgtcgaccgcgttggccct
tacgatcatgtcctgcggaccgccccgactgcccatgcccgtgttgccgatgtcggcgat
gtcccgttcaaaagccgcttcgatcttgcggcatcccatgacgatatcgagaaatttgtc
ggcggcttgataggggcgggagtcgtgcccctggccgtcggcggcgaccactcggtcggc
cttcccatactcagggccgtcggcagggatcgccctgtggggatgatccatatcgacgcc
cattgcgacacgggcggttcgttcgaaggatgcaaattccaccacggcggaccctttcgc
caggcggttctggacggtgtgcttgatcccaggcggacgatccagatcggaattcgcggc
aattccgaatatctatgggaattctcctatgcgtccggcatgaccgtcattcatgcggaa
gacgtcggtgatctcggcatcagcgccgtcatcgccaaggcaagagagatcgtcggggcg
gggccgacctatgtcagcttcgacgtcgattctctcgatcccgcattcgcgccaggcacc
ggaacgccggaggtcggcggcctgacctcggcgcaggcgcttggcattctgcgcggcctt
atcggcttgaacattgtcggcggcgacgttgtcgagatcgctccgcaatacgacccgacg
tcgaatacggcgcaaattgcggctcaggttttgttcgaactcctctgccttgcggccgag
gcaatcaaggttcgcgcgccctaa

DBGET integrated database retrieval system