KEGG   Rhizobium etli CFN 42: RHE_CH02175Help
Entry
RHE_CH02175       CDS       T00317                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Module
ret_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHE_CH02175 (trpC)
Enzymes [BR:ret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RHE_CH02175 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NuDC
Motif
Other DBs
NCBI-ProteinID: ABC90957
RhizoBase: RHE_CH02175
UniProt: Q2K879
Position
2279373..2280185
Genome map
AA seq 270 aa AA seqDB search
MSDILKKIELYKREEIAAAKAAVSLADLKAMQAGQSAPRGFYQALTAKREAGHFGLIAEI
KKASPSKGLIRPDFDPPALAKAYEAGGAACLSVLTDTPSFQGAPEFLTAARAACALPALR
KDFMFETYQVHEARAWGADCILLIMASLTDDEAERLQDESFSLGMDVLVEVHDASEMERA
LKLSSPLIGINNRNLRTFEVGLTVSETLASMVPDDRLLVGESGIFTHADCKRLQAAGINT
FLVGESLMRKDDVTAATRALLVGEAAIAAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcctgaagaagatcgaactctacaagcgcgaggaaatcgccgccgccaag
gcggcagtgtcgctggccgacctgaaggcgatgcaggcggggcagtccgcgccgcgcggt
ttttatcaggccctcacggccaagcgtgaggctggccatttcggcctgatcgccgagatc
aagaaggcaagcccgtccaagggcctcattcgtccggatttcgatccgccggcgctggcc
aaggcctacgaagccggcggcgcagcctgcctttccgtgctcaccgatacgccaagcttt
cagggtgcaccggaatttttgacggcggcgcgcgctgcctgcgccctgcccgctttgcgc
aaggacttcatgttcgagacctatcaggtgcatgaggcccgagcctggggcgccgattgc
attctgctgatcatggcgtcgctgaccgacgacgaggctgagcgtctgcaggacgaatct
ttttcgctcggcatggatgtactggtcgaggttcacgacgcgtcggaaatggaacgtgcg
ctgaagctgtcctcgccgcttatcggcatcaacaaccgcaacctcaggactttcgaagtc
ggcctgacggtcagcgagacgcttgcctccatggttcctgacgaccggctcctcgtcggc
gagagcggcatcttcacccatgccgattgcaagcgcctgcaggccgccggcatcaatacc
ttcctggtcggcgaaagcctgatgcgcaaggacgacgtgacggccgctacccgcgcgctg
ctcgtcggcgaagcggcaatcgcggccgaatga

DBGET integrated database retrieval system