KEGG   Rhizobium etli CFN 42: RHE_CH02186Help
Entry
RHE_CH02186       CDS       T00317                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_CH02186 (tpiA)
   01230 Biosynthesis of amino acids
    RHE_CH02186 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_CH02186 (tpiA)
   00051 Fructose and mannose metabolism
    RHE_CH02186 (tpiA)
   00562 Inositol phosphate metabolism
    RHE_CH02186 (tpiA)
Enzymes [BR:ret01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RHE_CH02186 (tpiA)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RHE_CH02186 (tpiA)
  Exosomal proteins of bladder cancer cells
   RHE_CH02186 (tpiA)
  Exosomal proteins of melanoma cells
   RHE_CH02186 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2291954..2292682)
Genome map
AA seq 242 aa AA seqDB search
MNGTRASLDQIKAIAEGVRPPLADKVEALICPPTTLLYVATALCTDSPLAIGAQDCHQKP
SGAHTGDISAEMIADSFGTYVIVGHSERRTDHAETDHLVRAKAEAAFAAELTAIICIGET
ADERRAGQELDVIKRQLSASVPDAATAENTVIAYEPIWAIGTGVTPTSGDVEKAHAFMRA
ELVSRFGDEGRKMRLLYGGSVKPANAGELLGIANVDGALIGGASLKAADFLAIYRAYEAL
LA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcacgcgtgcctccctggatcagatcaaggcgatcgccgagggtgttcgcccg
ccgctcgccgacaaggtcgaggcgctgatctgcccgccgacgacgctgctctacgtggcg
accgcgctctgcaccgacagcccgctggcgatcggcgcgcaggactgccaccagaagccg
tcgggcgcgcataccggcgacatttccgccgagatgatcgccgatagcttcggcacgtac
gtgattgtcggccattccgagcgtcgcaccgaccatgccgagacggatcatctggtccgc
gctaaagcggaggcggctttcgctgccgagctcaccgcgatcatctgcatcggcgagacg
gctgacgaacgccgcgccgggcaggagctcgacgtcatcaagcgccagctttccgcctcg
gttcccgatgccgcaacagccgaaaacacagtcatcgcctacgagccgatctgggcgatc
ggcaccggggtcacgccgacatcaggggatgtcgagaaggcgcatgccttcatgcgtgcg
gagctcgtctcccgcttcggcgacgaaggccgcaagatgcggcttctctatggcggctcc
gtcaagcccgccaatgccggggaactgttgggcatcgccaatgtcgacggcgcgctgatc
ggcggagcgagcttgaaagccgccgacttcctcgccatttaccgggcctatgaggcgctg
ctcgcctga

DBGET integrated database retrieval system