KEGG   Rhizobium etli CFN 42: RHE_CH02334Help
Entry
RHE_CH02334       CDS       T00317                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinas e protein (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ret  Rhizobium etli CFN 42
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ret00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2435796..2436314)
Genome map
AA seq 172 aa AA seqDB search
MPEATSQSATLGLGGNIGDPVKAMAAALQRLDERDDCRVTAVSRLYRTPPWGKTDQSFFF
NACAAVATRLPPEALLDVCLSIEREMKRERVERWGPRTLDIDVLTYGNVVQQAPRLELPH
PRMTDRGFVLMPLADIAPGLLVRGRPVSDWLLDADVTGIEVADDSGDWWRSA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaggctacatcgcaatcagccacactcggcctcggcggcaatatcggcgatccg
gtaaaggcgatggccgcggcgctgcagagactggacgagcgcgacgactgtcgtgtcacc
gccgtgtcgcggctctatcgcacgccgccatggggcaagacggaccaatcgttcttcttc
aatgcctgcgccgcggtcgcaacccggctccctccagaggcgctgctcgatgtctgcctt
tcgatcgagcgtgagatgaaacgcgagcgtgtcgagcgctggggaccgcgcacactcgat
atcgacgttctgacctatggcaacgtcgtccagcaggcgccgcggctggagttgccgcat
ccccgtatgaccgatcgcggtttcgtcctgatgccgcttgccgatatcgccccaggcctt
ctcgtcaggggccggccggtcagcgactggctgctcgacgccgacgtgaccggcatcgag
gtcgccgatgacagcggcgactggtggcggagcgcctga

DBGET integrated database retrieval system