KEGG   Rhizobium etli CFN 42: RHE_CH02386Help
Entry
RHE_CH02386       CDS       T00317                                 

Definition
(GenBank) putative sensory box/GGDEF family protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ret  Rhizobium etli CFN 42
Brite
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RHE_CH02386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
2497949..2499016
Genome map
AA seq 355 aa AA seqDB search
MNTAVVPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELAALGSQAT
QAELDALGAQYFTSSPARVFDDAHTRISGELDGLLRILRQEQSSLESYTRLLGETHKRIT
SKSNASVELIESAIELLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAVFNNPGMRPVTALLLADIDNFKKINDTYGHPVGDKILATVASVI
RSNVRRDVFVARAGGEEFALIIEGNTAEEVTAIAERIRRTLETTPFKNSRTRVNYGPITV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCIVLYQDGMQKDFSKSWLIYKA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgtgcccaaggtgcaggttcccgacgtagcgggccagatcacctac
gccatgcgctcgatgggcgtcgcgccgataccccgcaattacgaactcttctacgaggcg
tatatcggctccaatccggcgctcacccgcgaactcgcagctctcggcagccaggcgacc
caggccgaactcgatgcgctcggcgcgcagtatttcaccagcagccccgcacgcgttttc
gacgatgcccatacgcgcatatcaggcgaactcgacggcctgctgcggatcctgaggcag
gagcaaagttcgctcgaaagctatacaaggctgctcggcgagacacataagcgcatcacc
tccaagagcaatgccagcgtcgaattgatcgaaagcgctatcgaacttttgagccaggcg
actggcgataccatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gagatggaccaggtccgcaaggaactcgacgaatacaagcgcatcgccaacaccgattcg
ctgacgcgcctttccaaccgccgcgccttcgatgaccggctggcagcggtcttcaacaat
cccggcatgcgcccggtaacggccctgctcctcgccgacatcgacaacttcaagaagata
aacgacacctacggccatccagtcggcgacaagatcctcgccaccgtcgcctccgtcatc
cgcagcaatgttcggcgagacgtcttcgtcgcccgtgccggcggcgaggaatttgccctg
atcatcgagggcaacacagccgaggaagtgacggcgatcgccgaacgcatccgccgcacg
ctggaaaccacaccgttcaagaattcccgcacgcgggtgaattacggcccgatcaccgtt
tcgatcggcatctgcatggcctcgaatgcggaggatgccggcgaactctacagcaagacc
gacatcgccctttacggcgccaagaacgccggccgcaactgcatcgtcctctatcaggac
ggcatgcagaaggacttcagcaagagctggctgatttacaaggcctga

DBGET integrated database retrieval system