KEGG   Rhizobium etli CFN 42: RHE_CH02386Help
Entry
RHE_CH02386       CDS       T00317                                 

Definition
sensory box/GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
ret  Rhizobium etli CFN 42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2497949..2499016
Genome map
AA seq 355 aa AA seqDB search
MNTAVVPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELAALGSQAT
QAELDALGAQYFTSSPARVFDDAHTRISGELDGLLRILRQEQSSLESYTRLLGETHKRIT
SKSNASVELIESAIELLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAVFNNPGMRPVTALLLADIDNFKKINDTYGHPVGDKILATVASVI
RSNVRRDVFVARAGGEEFALIIEGNTAEEVTAIAERIRRTLETTPFKNSRTRVNYGPITV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCIVLYQDGMQKDFSKSWLIYKA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgtgcccaaggtgcaggttcccgacgtagcgggccagatcacctac
gccatgcgctcgatgggcgtcgcgccgataccccgcaattacgaactcttctacgaggcg
tatatcggctccaatccggcgctcacccgcgaactcgcagctctcggcagccaggcgacc
caggccgaactcgatgcgctcggcgcgcagtatttcaccagcagccccgcacgcgttttc
gacgatgcccatacgcgcatatcaggcgaactcgacggcctgctgcggatcctgaggcag
gagcaaagttcgctcgaaagctatacaaggctgctcggcgagacacataagcgcatcacc
tccaagagcaatgccagcgtcgaattgatcgaaagcgctatcgaacttttgagccaggcg
actggcgataccatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gagatggaccaggtccgcaaggaactcgacgaatacaagcgcatcgccaacaccgattcg
ctgacgcgcctttccaaccgccgcgccttcgatgaccggctggcagcggtcttcaacaat
cccggcatgcgcccggtaacggccctgctcctcgccgacatcgacaacttcaagaagata
aacgacacctacggccatccagtcggcgacaagatcctcgccaccgtcgcctccgtcatc
cgcagcaatgttcggcgagacgtcttcgtcgcccgtgccggcggcgaggaatttgccctg
atcatcgagggcaacacagccgaggaagtgacggcgatcgccgaacgcatccgccgcacg
ctggaaaccacaccgttcaagaattcccgcacgcgggtgaattacggcccgatcaccgtt
tcgatcggcatctgcatggcctcgaatgcggaggatgccggcgaactctacagcaagacc
gacatcgccctttacggcgccaagaacgccggccgcaactgcatcgtcctctatcaggac
ggcatgcagaaggacttcagcaagagctggctgatttacaaggcctga

DBGET integrated database retrieval system