KEGG   Rhizobium etli CFN 42: RHE_CH02396Help
Entry
RHE_CH02396       CDS       T00317                                 

Gene name
glpKch1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ret00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2506138..2507604)
Genome map
AA seq 488 aa AA seqDB search
MRAILAIDQGTTNSKAVLVSEKGEIIGRGSAPVGISYPKEGWVEQDPRRLYASVCEAIDA
CLKAGPDATIEAVAISNQRESVTAWDAETGDALGPVVSWQCRRTAPDCERLIVEGRLDRV
QALTGLPLDPMFPGSKFRWLLDRIPAGRSVRLGTVDSWLIHCLTGGRRHVCDASNAARSQ
LFDLREQRWSEELGEIFGVDIALLPEVLDSSGDFGRTQGLPGVPDGTPIMAAIGDSHAAL
FGHGAFKPGDGKVTFGTGSSVMTTLPQFIAPRNGITTTVAWRIAGKPTFAFEGNILVCAA
SLPWMADILGLADVAALVELAASAGPGAPGFVPAFVGLGAPYWNSGARALFSQINFNTTR
AQMARSVTDSIAFQVHDVIAAMRAQSGGELGALYVDGGPSQNRFLMQCVSDLIEHPVIQC
EAPEASALGAAYLAGLSLGLWSDLQVVSELPRNSQTIEPQVMDREALLATWNDALARSTS
RETQAKGE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaattctggcaatcgaccagggtacgaccaattcaaaggcagttctcgtttcc
gaaaagggagaaatcatcggcaggggttccgctccagtcggcatctcctatccgaaggaa
ggctgggtcgaacaagatccgcgccggctctacgcatcggtctgcgaagcgatcgacgcc
tgcctgaaggccggccccgatgcgacgatcgaggccgtagccatttccaaccagcgcgag
tccgttaccgcctgggatgccgaaacgggagatgcgctcggaccagtggtcagctggcag
tgccgtcgaacggcgccggattgcgaacgtctcattgtcgaaggccgcctcgaccgtgtg
caggcgctgaccggcctgccattggatccgatgtttccgggttcgaaattccgatggctg
ctcgaccggatcccggccgggcgatcggtgcggctgggaacggtcgacagttggctcatt
cactgcctgacgggcgggcgccggcatgtctgcgacgcttcgaatgccgccaggagccag
ttgttcgatctcagggaacagagatggagcgaggaacttggcgagatcttcggcgtcgat
atcgcgctcctgccggaggtgctcgacagctctggcgatttcggcagaacgcaaggattg
cccggggtgcccgacggcacgcctatcatggccgcgatcggagacagccacgcagccctg
ttcggccatggcgcattcaagccgggcgacggcaaggtgaccttcggcaccggctcttcg
gtcatgacgacgctgccgcaattcatcgccccgcgcaatggcatcacaaccaccgtcgca
tggcgcatcgcgggaaagccgaccttcgctttcgagggcaatatcctcgtttgcgccgcc
agccttccctggatggcggatattcttggcctggctgacgtggctgccctcgtcgaactt
gcggcgagcgccgggccgggcgcgcctggcttcgtgccggcgttcgtggggctgggtgcg
ccttactggaattccggcgcccgtgctttgttctcccagatcaacttcaatacgacacgc
gcgcagatggcgcggtcggtaaccgattccatcgccttccaggtgcatgatgtgatcgcg
gccatgcgggcgcagagcggcggcgaactcggggcgctctatgtggatgggggaccgagc
cagaaccgctttctgatgcagtgcgtctcggatcttatagagcatcccgtgatccaatgc
gaagcacccgaggcgtcggctctcggcgccgcttatctggcgggcctctccctcggcttg
tggagcgatctccaagtcgtctcggagctgccgcgaaacagccagaccatcgagccgcag
gtcatggaccgagaggcccttctggcgacctggaatgatgcgcttgcccgctcgacgtcc
cgcgaaacacaggctaaaggtgaataa

DBGET integrated database retrieval system