KEGG   Rhizobium etli CFN 42: RHE_CH02618Help
Entry
RHE_CH02618       CDS       T00317                                 

Definition
cytochrome-c protein
Orthology
K08738  
cytochrome c
Organism
ret  Rhizobium etli CFN 42
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ret00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ret02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2731656..2732057)
Genome map
AA seq 133 aa AA seqDB search
MRFAVDYRVILLTAAPVIALFPLNAGAQEGDAAAGATVFKKCATCHVAESDTNKVGPSLN
KLFGRKAGTHPDFAYSAGMKAAGEGGLVWDEATLRDYLHNPKAKVKGTKMAFAGVKDDQE
ITNLIAYLKQYSQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgccgtggattaccgtgttattctgctgaccgccgcgcccgtcattgccctt
ttccctctcaacgctggagcgcaggagggggatgcggcggccggtgccaccgttttcaag
aaatgtgccacctgtcatgtcgccgagtccgatacgaacaaggtgggtccgtcactgaac
aagctgttcggccgaaaggccgggacgcatcctgattttgcttattctgcggggatgaag
gccgccggcgagggtggtctcgtctgggacgaggcgacgttgcgtgactatctgcataat
ccgaaagccaaggtgaagggcaccaagatggccttcgcaggagtgaaggatgaccaggaa
atcaccaatctcatcgcctatctgaaacaatattcccaatga

DBGET integrated database retrieval system