KEGG   Rhizobium etli CFN 42: RHE_CH02656Help
Entry
RHE_CH02656       CDS       T00317                                 

Gene name
lacZ1
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ret  Rhizobium etli CFN 42
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHE_CH02656 (lacZ1)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RHE_CH02656 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2768024..2770009)
Genome map
AA seq 661 aa AA seqDB search
MAEFAWHILEPKLGTYDFDLFDRAIAILGRHGIDTIMCTPTATPPRWLTAAHPEILRVDG
KGRPMSHGSRQHCDTASPVFREYSKRITRAMAEHYRGNPFVVGWQTDNELNTSMPESFSK
ATLTEFQTFLADKYREIAKLNAAWGGDFWATAYDSFDQVVLPIEFGPTFPSPGHLQDYHR
FLAFSTARFQHDQVEILRAVKPSWFVFHNLGGLRDIDFRGQFSKDLDFVGYDIYPMLYDE
FQRLGNHAKVQALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAH
GADGLMFFRWRPAHFGAEIYWMGIIDHDDIGRHRYEEAKRFANEMTALQPKILGTFVRMD
VGIAGSDFDNQEAHKTYPIGLPSPQDDAILLHQHCYDRGIACGFIHPEDDLSRLKLFYVP
HWVMWKDEWTDKLEAFAVSGGTVIIGARTGTRNEDNHVIRETAPGTALSKLTGVRVEDFG
RLAAPGANGLFDVMERSGGLVIPPNKPAESNRRQRRFKIGNREMTAGHFYENLTIDPDVE
VIAIWSNRYAEGQPMATSRKIGKGQVVYLGTYLTPELTEALTERLFAPAGVEPLVGGLPE
GVEVTMRMNDERRLLFVQNYMDQAVTVGGVPAGRDLLDGEKKVTGRLELQGYGCAIVELE
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgcctggcacattctggaacccaagctcggcacctatgatttcgacctg
ttcgaccgcgccatagcaatcctcgggcgccacggcatcgacaccatcatgtgcacgccg
accgccacgccgccgcgctggctgaccgcggcccatcctgagattttaagggtggacggc
aagggccggccgatgagccatggctcgcgccagcactgcgacacggcaagccccgtcttc
cgcgaatacagcaagcgcatcacccgcgcgatggccgagcattatcgcggcaaccccttc
gtcgtcggctggcagactgataacgagctcaacaccagcatgccggagagcttttccaag
gcgacgctcaccgaattccagacctttctcgctgataaatatcgcgagattgcgaagctc
aacgccgcctggggcggcgatttctgggcgacggcctatgacagcttcgaccaggtggtg
ctgccgatcgaattcggcccgacctttccgagccccggccatctgcaggattaccaccgc
ttcctcgccttctccaccgcgcgcttccagcacgaccaggtcgagatcctgcgcgcagtc
aaaccctcctggttcgtcttccacaacctcggcggcttgcgggacatcgatttccgcggc
cagttcagcaaggatctcgatttcgtcggctatgacatctacccgatgctctatgacgag
ttccaacggctcggcaaccacgccaaggtgcaggcgctgcacctcgatatctgccgcggc
ttctccggcaattacatcgtgcccgagcagcaatcgggcttcggcagccagccgggcttc
tgcacgctgacaccggagccgggcgagctgcgccgcatggcgctctcctcggtcgcccac
ggtgccgacggtctgatgttcttccgctggcggcccgcccatttcggcgccgaaatctat
tggatgggtatcatcgaccatgacgatatcggccgccatcgctatgaggaggccaagcgc
tttgcgaacgaaatgacggcgctgcagcccaagatcctcggcacctttgtccgcatggat
gtcggcatcgccggctccgatttcgacaatcaggaagcccacaagacctatccgatcggc
ctgccgagcccgcaggacgacgcgatcctgctgcatcagcactgctacgatcgcggcatc
gcctgcggcttcatccaccccgaggacgatctttccaggctgaagctcttctacgtcccc
cattgggtgatgtggaaggacgaatggacagacaagctcgaagccttcgctgtgtcaggc
ggcaccgtcatcatcggcgcgcgcaccggcacgcgcaacgaggataatcacgtcatccgc
gaaaccgctcccggcaccgcgctttcgaagctgacgggcgtgcgcgtcgaagatttcggc
cgtctcgccgcccccggcgccaacggcctcttcgacgtgatggaacgctccggcggcctt
gtcatcccgccgaacaagcccgccgaaagcaaccgccgccaacgccgcttcaagattggc
aaccgcgaaatgaccgccggccatttctacgaaaacctcaccattgaccccgacgtcgag
gtgatcgccatctggtccaaccgctacgccgaaggccaaccgatggcgacctcccgcaag
atcggcaaggggcaggtggtctatctcggcacttatctcacgcctgagctgaccgaggcg
ctgaccgaacggctgtttgcaccggcaggcgtggagccgctggtcggcgggttgcccgag
ggcgtggaggtgacgatgcggatgaacgacgagcggcggctgctgtttgtgcagaattat
atggatcaggcggtgacggtgggcggggtgcctgccgggcgggatctgctggatggggag
aagaaggtgacgggcaggctggagcttcaggggtatgggtgtgcgattgtggagttggag
gggtga

DBGET integrated database retrieval system