KEGG   Rhizobium etli CFN 42: RHE_CH02656Help
Entry
RHE_CH02656       CDS       T00317                                 

Gene name
lacZ1
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ret  Rhizobium etli CFN 42
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ret00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2768024..2770009)
Genome map
AA seq 661 aa AA seqDB search
MAEFAWHILEPKLGTYDFDLFDRAIAILGRHGIDTIMCTPTATPPRWLTAAHPEILRVDG
KGRPMSHGSRQHCDTASPVFREYSKRITRAMAEHYRGNPFVVGWQTDNELNTSMPESFSK
ATLTEFQTFLADKYREIAKLNAAWGGDFWATAYDSFDQVVLPIEFGPTFPSPGHLQDYHR
FLAFSTARFQHDQVEILRAVKPSWFVFHNLGGLRDIDFRGQFSKDLDFVGYDIYPMLYDE
FQRLGNHAKVQALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAH
GADGLMFFRWRPAHFGAEIYWMGIIDHDDIGRHRYEEAKRFANEMTALQPKILGTFVRMD
VGIAGSDFDNQEAHKTYPIGLPSPQDDAILLHQHCYDRGIACGFIHPEDDLSRLKLFYVP
HWVMWKDEWTDKLEAFAVSGGTVIIGARTGTRNEDNHVIRETAPGTALSKLTGVRVEDFG
RLAAPGANGLFDVMERSGGLVIPPNKPAESNRRQRRFKIGNREMTAGHFYENLTIDPDVE
VIAIWSNRYAEGQPMATSRKIGKGQVVYLGTYLTPELTEALTERLFAPAGVEPLVGGLPE
GVEVTMRMNDERRLLFVQNYMDQAVTVGGVPAGRDLLDGEKKVTGRLELQGYGCAIVELE
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgcctggcacattctggaacccaagctcggcacctatgatttcgacctg
ttcgaccgcgccatagcaatcctcgggcgccacggcatcgacaccatcatgtgcacgccg
accgccacgccgccgcgctggctgaccgcggcccatcctgagattttaagggtggacggc
aagggccggccgatgagccatggctcgcgccagcactgcgacacggcaagccccgtcttc
cgcgaatacagcaagcgcatcacccgcgcgatggccgagcattatcgcggcaaccccttc
gtcgtcggctggcagactgataacgagctcaacaccagcatgccggagagcttttccaag
gcgacgctcaccgaattccagacctttctcgctgataaatatcgcgagattgcgaagctc
aacgccgcctggggcggcgatttctgggcgacggcctatgacagcttcgaccaggtggtg
ctgccgatcgaattcggcccgacctttccgagccccggccatctgcaggattaccaccgc
ttcctcgccttctccaccgcgcgcttccagcacgaccaggtcgagatcctgcgcgcagtc
aaaccctcctggttcgtcttccacaacctcggcggcttgcgggacatcgatttccgcggc
cagttcagcaaggatctcgatttcgtcggctatgacatctacccgatgctctatgacgag
ttccaacggctcggcaaccacgccaaggtgcaggcgctgcacctcgatatctgccgcggc
ttctccggcaattacatcgtgcccgagcagcaatcgggcttcggcagccagccgggcttc
tgcacgctgacaccggagccgggcgagctgcgccgcatggcgctctcctcggtcgcccac
ggtgccgacggtctgatgttcttccgctggcggcccgcccatttcggcgccgaaatctat
tggatgggtatcatcgaccatgacgatatcggccgccatcgctatgaggaggccaagcgc
tttgcgaacgaaatgacggcgctgcagcccaagatcctcggcacctttgtccgcatggat
gtcggcatcgccggctccgatttcgacaatcaggaagcccacaagacctatccgatcggc
ctgccgagcccgcaggacgacgcgatcctgctgcatcagcactgctacgatcgcggcatc
gcctgcggcttcatccaccccgaggacgatctttccaggctgaagctcttctacgtcccc
cattgggtgatgtggaaggacgaatggacagacaagctcgaagccttcgctgtgtcaggc
ggcaccgtcatcatcggcgcgcgcaccggcacgcgcaacgaggataatcacgtcatccgc
gaaaccgctcccggcaccgcgctttcgaagctgacgggcgtgcgcgtcgaagatttcggc
cgtctcgccgcccccggcgccaacggcctcttcgacgtgatggaacgctccggcggcctt
gtcatcccgccgaacaagcccgccgaaagcaaccgccgccaacgccgcttcaagattggc
aaccgcgaaatgaccgccggccatttctacgaaaacctcaccattgaccccgacgtcgag
gtgatcgccatctggtccaaccgctacgccgaaggccaaccgatggcgacctcccgcaag
atcggcaaggggcaggtggtctatctcggcacttatctcacgcctgagctgaccgaggcg
ctgaccgaacggctgtttgcaccggcaggcgtggagccgctggtcggcgggttgcccgag
ggcgtggaggtgacgatgcggatgaacgacgagcggcggctgctgtttgtgcagaattat
atggatcaggcggtgacggtgggcggggtgcctgccgggcgggatctgctggatggggag
aagaaggtgacgggcaggctggagcttcaggggtatgggtgtgcgattgtggagttggag
gggtga

DBGET integrated database retrieval system