KEGG   Rhizobium etli CFN 42: RHE_CH02716Help
Entry
RHE_CH02716       CDS       T00317                                 

Gene name
chrA
Definition
chromate transporter
Orthology
K07240  
chromate transporter
Organism
ret  Rhizobium etli CFN 42
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2828182..2829603)
Genome map
AA seq 473 aa AA seqDB search
MVDMTENAPAGQAGNKDAGEGHHHGVSFGEAFRVWLRVAALSFGGPAGQIAVMHRIIVDE
KRWIGEHRFLHALNYCMLLPGPEAQQLAVYIGWLMHRTFGGLVAGVLFVLPGFLSILGLS
YVYAAYGSIGIVAGLFFGLKAAVLAVVVQAVIRIGSRALRNRVMLAVAAAAFVAIFFFHV
PFPLIVLAAGIIGFFGGRLGLDTFKAGGGHKAASGAVLSDAESALGEGIPAHARANLAWS
LRISAILLALWLVPVAVLYTFFGPGDVFSQIGLFFSKMAVVTFGGAYAALAYVAQQAVQH
FGWLKPGEMLDGLGMAETTPGPLIMVLQFVGFMAAFRNPGSLDPMLAATLAAILTTWVTF
VPCFLWIFLGAPFIEKLRGNVALAGAMSAITAAVVGVILNLAIWFGLHTLFAEVAQVSFG
NLRLDIPELQSAVPAAIALSVAAAIALFRFKTSVIATLFGCAIAGMLWTLAMN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatgacggagaatgcgcccgccggacaggcgggcaacaaggacgcgggcgag
gggcatcaccacggcgtttcgtttggggaggccttccgggtgtggctgcgtgtcgccgcc
ttgagcttcggcggcccggccggccagatcgcggtcatgcaccggatcatcgtcgacgag
aagcgatggatcggcgagcaccgcttcctgcatgccttgaattattgcatgctgctcccc
gggcccgaggcgcagcagcttgccgtctatatcggctggctgatgcaccgcacattcggc
ggtctcgtcgccggcgtgctcttcgtgctgccgggcttcctgtcgatcctcggcctcagc
tatgtctacgctgcttacggcagcatcggcatcgtcgccggcctgttcttcggcctgaag
gcggccgtccttgccgtcgtcgtgcaggccgtcatccgcatcgggagccgggcgctgaga
aaccgcgtcatgcttgccgtcgcggccgccgccttcgtcgccatcttcttcttccacgtg
ccgttcccgctgattgtgctggccgcgggaatcatcggcttcttcggcggccggctcggc
ctcgacaccttcaaggcgggcggcggccacaaggccgcaagcggcgcggtgctgtcggat
gccgagtcggcgcttggcgagggtattccggcgcatgcgcgcgccaacctcgcctggtcg
ctgcgcatatcggctatactgctcgccctctggctggtgccggtcgccgtcctttacacg
ttcttcggaccaggtgacgtcttcagccagatcggcctcttcttcagcaagatggcggtc
gtcaccttcggtggcgcctatgccgcgctcgcctacgtcgcgcagcaggccgtgcagcat
ttcggctggctgaaacccggcgagatgctggacggtctcggcatggccgagaccacgccg
gggccgctgatcatggtgctccagttcgtcggcttcatggccgcctttcgcaatcccggc
tcgctcgatccgatgcttgccgccacccttgccgcgatcctgacgacatgggtaaccttc
gtgccctgtttcctctggatattcctcggtgcgcccttcatcgaaaagctgcgcggcaat
gtggcgcttgccggggcaatgtcggcgatcacggcggcggtggtcggggtcatactcaac
ctcgccatctggttcgggctgcacacgctgtttgccgaagtcgcgcaggtcagtttcgga
aacctgcggctcgatattcctgagctgcaatctgccgtaccggcggcaatcgcgctctcc
gtcgctgccgccatcgcgctcttccgcttcaagacctcagttattgcgacgctcttcggg
tgtgcgatcgcaggcatgctctggacgctggcgatgaattga

DBGET integrated database retrieval system