KEGG   Rhizobium etli CFN 42: RHE_CH02821Help
Entry
RHE_CH02821       CDS       T00317                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ret  Rhizobium etli CFN 42
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ret00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2943192..2943818
Genome map
AA seq 208 aa AA seqDB search
MKALLLVDIQNGFCPGGNLPVPDGDKVVPVANRLIDSGKYDLIVASQDWHPPGHGSFASA
HPGAVPFEMGELSGKPQMMWPDHCVQGTLDAELHPALQSEEIDLIQQKGENPKIDSYSAF
RDNDRDASTGLSDFLEDQGVTDLDVCGLATDYCVKFSALDALEMMPGIRVRFIEDASRGI
TPEGVAAAIDEMRAHGIAIIDSAKALAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctcctgctcgtcgatatccagaacggcttctgtccgggaggaaacctgccg
gtgccggacggcgacaaggtcgttcccgtcgcaaacaggctgatcgacagcggcaaatac
gatctgatcgtcgcctcccaggactggcatccgccgggccacggcagtttcgcctccgcc
catccgggcgccgtccccttcgagatgggcgaactctctggcaagccgcagatgatgtgg
ccggaccactgcgtccagggcacgctcgatgccgaactgcatcccgcgctccaatccgaa
gagatcgacctgatccagcagaagggcgagaatcccaagatcgacagctattcggccttt
cgcgataatgaccgggatgcctcgaccggcctttccgacttcctcgaagaccagggcgtc
accgatctcgatgtctgcggcctcgccaccgattactgcgtcaagttctccgcgctcgat
gcgctggaaatgatgccgggcatacgggtgcgcttcatcgaggacgccagccgcggcatc
actcccgaaggcgtcgccgccgccatcgacgagatgcgggcgcatggcatcgcgattatc
gacagcgccaaggctctggccggctaa

DBGET integrated database retrieval system